DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and ZBTB49

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001317554.1 Gene:ZBTB49 / 166793 HGNCID:19883 Length:765 Species:Homo sapiens


Alignment Length:391 Identity:85/391 - (21%)
Similarity:132/391 - (33%) Gaps:113/391 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 NLLLQGKLECDLHPEIPA-CTAPARLMEKLPAL---------GQNFRCGWTDCEREFVSIVEFQD 152
            |.|.|...:...|||..| |..|.:.|....|:         .|.:        .|.||..:..|
Human   275 NFLAQPVNDSAPHPESDATCQQPVKQMRLKKAIHLKKLNFLKSQKY--------AEQVSEPKSDD 331

  Fly   153 HIV-------KHALFEYDIQKTPEDERPKTM-CNWAMC---HKHMGNKYRLIEHISTHSNKKQVA 206
            .:.       |:.|.:...|...|.|..:.: |....|   .:...:...|.:...|..:::|.|
Human   332 GLTKRLESASKNTLEKASSQSAEEKESEEVVSCENFNCISETERPEDPAALEDQSQTLQSQRQYA 396

  Fly   207 CFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVNCYKCTMCDMTCS 271
            |..||:.|:..:.|  .|.::.......|:|..|.|.|                          |
Human   397 CELCGKPFKHPSNL--ELHKRSHTGEKPFECNICGKHF--------------------------S 433

  Fly   272 SASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHS-KTVHQC--------------E 321
            .|.:|.||:| ||..:||..|..|..|.....|:.:|: |:|| :..|.|              |
Human   434 QAGNLQTHLR-RHSGEKPYICEICGKRFAASGDVQRHI-IIHSGEKPHLCDICGRGFSNFSNLKE 496

  Fly   322 HPDCHYSVRTYT------------QMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKHG 374
            |...|.:.:.:|            ::.:|.:...|..|  |:|..|.:.|.....|..|:     
Human   497 HKKTHTADKVFTCDECGKSFNMQRKLVKHRIRHTGERP--YSCSACGKCFGGSGDLRRHV----- 554

  Fly   375 FRLPSGHKRFTYRVDENGFYRLETTR----------------LESLE---VTQQILSPQVNDSLA 420
             |..:|.|.:|..:....|.|....|                ||.|.   .|..:...|.:||.:
Human   555 -RTHTGEKPYTCEICNKCFTRSAVLRRHKKMHCKAGDESPDVLEELSQAIETSDLEKSQSSDSFS 618

  Fly   421 K 421
            :
Human   619 Q 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 2/19 (11%)
C2H2 Zn finger 207..225 CDD:275368 5/17 (29%)
C2H2 Zn finger 237..257 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 5/18 (28%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
ZBTB49NP_001317554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..294 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.