DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and CTCFL

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001255972.1 Gene:CTCFL / 140690 HGNCID:16234 Length:700 Species:Homo sapiens


Alignment Length:190 Identity:62/190 - (32%)
Similarity:90/190 - (47%) Gaps:14/190 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 STHSNKKQVAC---FHCGELFRTKTTLFDHLRRQPENNTNS--FQCAQCFKFFATKKLLKSHVVR 256
            ||.:.:|....   |||.....|.:.: ....|..:.:|:.  ..|..|.|.|.|..||::||..
Human   243 STKNQRKT
KGAKGTFHCDVCMFTSSRM-SSFNRHMKTHTSEKPHLCHLCLKTFRTVTLLRNHVNT 306

  Fly   257 HVNC--YKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQ 319
            |...  |||..|:|...::..|..|.||:|..:||.|||.|....|..|.|.:||:....:...|
Human   307 HTGTRPYKCNDCNMAFVTSGELVRHRRYKHTHEKPFKCSMCKYASVEASKLKRHVRSHTGERPFQ 371

  Fly   320 CEHPDCHYSVRTYTQMRRHFLEVHGNNPILYACHCCE-RFFKSGKSLSAHLMKKHGFRLP 378
            |  ..|.|:.|...:::||.....|..|  |.||.|. ||.:|| ::..|:::|||..:|
Human   372 C--CQCSYASRDTYKLKRHMRTHSGEKP--YECHICHTRFTQSG-TMKIHILQKHGENVP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 1/1 (100%)
C2H2 Zn finger 207..225 CDD:275368 4/20 (20%)
C2H2 Zn finger 237..257 CDD:275368 9/19 (47%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 8/18 (44%)
C2H2 Zn finger 352..373 CDD:275368 8/21 (38%)
CTCFLNP_001255972.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..250 2/6 (33%)
COG5048 <259..403 CDD:227381 47/148 (32%)
C2H2 Zn finger 259..279 CDD:275368 3/20 (15%)
zf-H2C2_2 271..296 CDD:290200 6/24 (25%)
C2H2 Zn finger 287..307 CDD:275368 9/19 (47%)
zf-H2C2_2 300..324 CDD:290200 9/23 (39%)
C2H2 Zn finger 315..333 CDD:275368 5/17 (29%)
C2H2 Zn finger 344..364 CDD:275368 8/19 (42%)
zf-H2C2_2 357..378 CDD:290200 6/22 (27%)
C2H2 Zn finger 372..392 CDD:275368 6/21 (29%)
zf-H2C2_2 385..409 CDD:290200 10/25 (40%)
C2H2 Zn finger 400..417 CDD:275368 7/17 (41%)
C2H2 Zn finger 430..448 CDD:275368
C2H2 Zn finger 460..480 CDD:275368
C2H2 Zn finger 488..508 CDD:275368
zf-H2C2_2 500..525 CDD:290200
C2H2 Zn finger 516..534 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 569..630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.