DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17829 and AgaP_AGAP011404

DIOPT Version :9

Sequence 1:	NP_652054.1	Gene:	CG17829 / 47718	FlyBaseID:	FBgn0025635	Length:	467	Species:	Drosophila melanogaster
Sequence 2:	XP_317912.2	Gene:	AgaP_AGAP011404 / 1278291	VectorBaseID:	AGAP011404	Length:	410	Species:	Anopheles gambiae

Alignment Length:	138	Identity:	34/138 - (24%)
Similarity:	54/138 - (39%)	Gaps:	11/138 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   167 TPED-------ERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHL 224
            ||::       |||:......:|.:.......|..|:..|.:::...|.||...||..:.|..|:
Mosquito   270 TPKEDDCWLLQERPRVKRKRHLCDECGALTNHLKSHVRYHRDERLEVCPHCPATFRHVSNLRGHI 334

  Fly   225 RRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVN---CYKCTMCDMTCSSASSLTTHIRYRHLK 286
             :|.........|..|.|.|...|..:.|::.|.|   .::|..|..:.|:...|..|....|..
Mosquito   335 -QQIHVKKICKTCEICGKGFIHHKTYRYHMLNHANEGKRFECKDCGKSFSNEIYLRDHYNRLHNI 398

  Fly   287 DKPLKCSE 294
            .|.|..|:
Mosquito   399 TKTLVASD 406

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17829	NP_652054.1	C2H2 Zn finger	182..199	CDD:275368	3/16 (19%)
		C2H2 Zn finger	207..225	CDD:275368	7/17 (41%)
		C2H2 Zn finger	237..257	CDD:275368	6/19 (32%)
		C2H2 Zn finger	263..284	CDD:275368	5/20 (25%)
		C2H2 Zn finger	292..311	CDD:275368	1/3 (33%)
		C2H2 Zn finger	352..373	CDD:275368
AgaP_AGAP011404	XP_317912.2	zf-AD	12..85	CDD:214871
		C2H2 Zn finger	292..309	CDD:275368	3/16 (19%)
		C2H2 Zn finger	317..338	CDD:275368	8/21 (38%)
		C2H2 Zn finger	346..366	CDD:275368	6/19 (32%)
		C2H2 Zn finger	375..396	CDD:275368	5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X96
TreeFam	0	0.000	Not matched by this tool.
	1	1.000