DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and AgaP_AGAP000164

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_310974.5 Gene:AgaP_AGAP000164 / 1272099 VectorBaseID:AGAP000164 Length:286 Species:Anopheles gambiae


Alignment Length:217 Identity:52/217 - (23%)
Similarity:91/217 - (41%) Gaps:24/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 QKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFD-----HL 224
            ::|..::..|.:|:  :|...:.   .|..|...|:.:...||.:|......|:.|..     ||
Mosquito    78 KQTVAEDASKKLCD--ICGAFVA---ELNGHRRVHTKEAPYACDYCSIRMTHKSNLLRHIDSVHL 137

  Fly   225 RRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVNC---YKCTMCDMTCSSASSLTTHIRYRHLK 286
            :|..:      :|.||.|.|.:.....||:..|.:.   |:|..|....:..|||..|....|..
Mosquito   138 KRIIK------RCEQCDKGFTSYFSYGSHMRSHHSTEKKYECKTCCKKFNHHSSLWLHNIRTHQD 196

  Fly   287 DKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYA 351
            ::..||:.|......:..|..|.:...|:..:.|:|  |....:|....:.|.|...|   |:::
Mosquito   197 ERKYKCTTCGLPWKTKESLRTHERSHSSEQPYACQH--CPKRFKTRYGWKSHELTHTG---IVFS 256

  Fly   352 CHCCERFFKSGKSLSAHLMKKH 373
            |..|::.|:....::||:.|.|
Mosquito   257 CQLCDKTFRYKTLINAHIRKAH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..225 CDD:275368 5/22 (23%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 4/18 (22%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
AgaP_AGAP000164XP_310974.5 C2H2 Zn finger 90..107 CDD:275368 4/21 (19%)
C2H2 Zn finger 115..140 CDD:275368 6/24 (25%)
C2H2 Zn finger 144..165 CDD:275368 7/20 (35%)
C2H2 Zn finger 173..194 CDD:275368 6/20 (30%)
C2H2 Zn finger 202..222 CDD:275368 4/19 (21%)
zf-H2C2_2 214..239 CDD:290200 6/26 (23%)
C2H2 Zn finger 230..250 CDD:275368 6/21 (29%)
C2H2 Zn finger 257..275 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X96
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.