DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and AgaP_AGAP011181

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_309466.4 Gene:AgaP_AGAP011181 / 1270746 VectorBaseID:AGAP011181 Length:346 Species:Anopheles gambiae


Alignment Length:342 Identity:76/342 - (22%)
Similarity:113/342 - (33%) Gaps:99/342 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTEHQCTWNSCDFRTENQVEFERHSYYHGYY 96
            |:|:....|....| .|..|...:.||.....::..:.|.        .|::|:           
Mosquito    68 CREVDQKLWHRRQH-SDKTEGAVQEQDPANTLSQSNDEQA--------PESKVQ----------- 112

  Fly    97 LNLLLQGKLECDLHPEIPACTAPARLMEKLPALGQNFRCGWTDCEREFVSIVEFQDHIVKHALFE 161
                         |..:           |......|..|.......||. :||..|   .|..:|
Mosquito   113 -------------HMHV-----------KSDEASPNPPCDGKSTNEEFY-VVELTD---AHHEYE 149

  Fly   162 YDIQKTPEDER----PKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFD 222
            .|:   |..|.    |.|..:.|..:           |:..|:.:|:..|..|...|..|..|..
Mosquito   150 LDL---PGSESIPVPPATTTSNATDN-----------HMLVHTGEKRYVCPVCQRAFAQKGNLTY 200

  Fly   223 HLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVNCYKCTMCDMTCSSASSLTTHIRYRHLKD 287
            ||      |.::..|.                      |:|..||.......||..|:|| |.:.
Mosquito   201 HL------NQHTGHCP----------------------YRCDQCDKAFKDPHSLVVHMRY-HTQS 236

  Fly   288 KPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYAC 352
            ||..||||::..|..|.|.||::....:..:||  .:|..|.::...:|.|.|. | .....:.|
Mosquito   237 KPFACSECESSFVNSSGLKKHLRTHTGERPYQC--GECKKSFKSSHNLRLHKLS-H-TKERRFQC 297

  Fly   353 HCCERFFKSGKSLSAHL 369
            ..|||:|.....|..|:
Mosquito   298 DLCERWFSYKNVLQTHM 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 1/16 (6%)
C2H2 Zn finger 207..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 237..257 CDD:275368 1/19 (5%)
C2H2 Zn finger 263..284 CDD:275368 8/20 (40%)
C2H2 Zn finger 292..311 CDD:275368 9/18 (50%)
C2H2 Zn finger 352..373 CDD:275368 7/18 (39%)
AgaP_AGAP011181XP_309466.4 C2H2 Zn finger 213..233 CDD:275368 8/20 (40%)
zf-H2C2_2 225..250 CDD:290200 12/25 (48%)
C2H2 Zn finger 241..261 CDD:275368 9/19 (47%)
zf-H2C2_2 254..278 CDD:290200 7/25 (28%)
C2H2 Zn finger 269..289 CDD:275368 6/22 (27%)
C2H2 Zn finger 297..317 CDD:275368 7/18 (39%)
zf-AD 5..75 CDD:285071 2/6 (33%)
COG5048 <116..302 CDD:227381 59/247 (24%)
zf-H2C2_2 172..194 CDD:290200 6/32 (19%)
C2H2 Zn finger 185..205 CDD:275368 8/25 (32%)
zf-C2H2 211..233 CDD:278523 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X96
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.