DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and AgaP_AGAP007514

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_308362.4 Gene:AgaP_AGAP007514 / 1269713 VectorBaseID:AGAP007514 Length:525 Species:Anopheles gambiae


Alignment Length:403 Identity:88/403 - (21%)
Similarity:137/403 - (33%) Gaps:96/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPQSSVPAPQPPGKRKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHT 67
            |..||.|..:.|.:.:.|...:.:.......::.                 |:.::|...|..:.
Mosquito   164 RSDSSSPDRRKPKRERNPKRPQTSDNETKQSKVA-----------------AQKEEDESLHNFYK 211

  Fly    68 EHQCTWNSCDFRT----ENQVEFERHSYYHGYYLNLLLQGKLECDLHPEI----PACTAPARLME 124
            ...|  ..||.:.    |.|::|       |.:..||...| |...|.::    |.|....|..:
Mosquito   212 RIVC--EVCDIQRMLVGEPQIDF-------GTWRALLRHTK-EVHKHDKVYVKCPVCEMKMRTKQ 266

  Fly   125 KL---------PALGQNFRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWA 180
            .|         |   :.:||..  |..             ||...:..||...::.  :..|:  
Mosquito   267 TLLQHMDWHENP---EKYRCEL--CGE-------------KHQNMKEHIQNKHQER--QFCCD-- 309

  Fly   181 MCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFA 245
            :|.|....|.||..|:.....:|.:.|..|.:.| ||.|:.||.|   ..::..|.|..|.|.|.
Mosquito   310 VCGKKFPFKKRLTVHMKKMHVEKDIICDQCQKPF-TKYTIEDHKR---SVHSARFVCEHCPKTFN 370

  Fly   246 TKKLLKSHVVRHVNCYK------CTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDT--RCVRE 302
            ::..|..|:..|....:      ||:|.........||.||:..|.....:.|..|..  :|.| 
Mosquito   371 SRFRLLQHMEEHDESLRNSTSVPCTICGQVMRDKYILTRHIKLMHTVQPAVSCETCGKTFKCKR- 434

  Fly   303 SDLAKHVQIVHSKTVHQCEHPD-------CHYSVRTYTQMRRHFLEVHGNNPILYACHCCERFFK 360
             :|:.|:..|       |..|.       |....|...:::.| :..|...| ||.|..|...|:
Mosquito   435 -NLSVHMTNV-------CMEPTRLYPCTICGKEFRRKNKLKEH-MSTHTGKP-LYMCSFCPETFR 489

  Fly   361 SGKSLSAHLMKKH 373
            ....|..|....|
Mosquito   490 QDTHLYHHRKNAH 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..225 CDD:275368 8/17 (47%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 6/20 (30%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
AgaP_AGAP007514XP_308362.4 zf-AD 6..74 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..300 CDD:275368 6/31 (19%)
C2H2 Zn finger 308..328 CDD:275368 7/21 (33%)
C2H2 Zn finger 336..356 CDD:275368 9/23 (39%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
C2H2 Zn finger 394..415 CDD:275368 7/20 (35%)
C2H2 Zn finger 423..445 CDD:275368 7/30 (23%)
C2H2 Zn finger 453..473 CDD:275368 3/20 (15%)
C2H2 Zn finger 481..499 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.