DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and AgaP_AGAP012741

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_306506.3 Gene:AgaP_AGAP012741 / 1267949 VectorBaseID:AGAP012741 Length:390 Species:Anopheles gambiae


Alignment Length:184 Identity:45/184 - (24%)
Similarity:75/184 - (40%) Gaps:15/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 HISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRH-- 257
            ||::|:.:...||.||......|..|..|:::..|.....: |..|.|.|..|....||:|.|  
Mosquito   209 HIASHNKQANFACPHCPVKMINKCNLMRHVKQVHEKRIIMY-CELCGKGFTHKNNYVSHMVSHNI 272

  Fly   258 VNCYKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEH 322
            ...|.|::|.:......:|..|.|..|| ::...|:.|.........|.:|      :.||..|.
Mosquito   273 GRTYDCSVCFVKFRHQGALRNHFRSVHL-NETFPCATCGMVFRTPERLKRH------QPVHSTEQ 330

  Fly   323 P-DCHYSVRTYTQMRRHFLEVH--GNNPILYACHCCERFFKSGKSLSAHLMKKH 373
            | .|....:.:..  |:...:|  .:..:::.|..|::.::....|..|..|.|
Mosquito   331 PYVCRQCPKRFKY--RYARTIHEITHTGVIFRCRHCDKSYRYKAQLKVHQRKTH 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 2/3 (67%)
C2H2 Zn finger 207..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
C2H2 Zn finger 263..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 292..311 CDD:275368 4/18 (22%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
AgaP_AGAP012741XP_306506.3 zf-AD <1..46 CDD:214871
C2H2 Zn finger 196..213 CDD:275368 2/3 (67%)
C2H2 Zn finger 221..242 CDD:275368 6/20 (30%)
C2H2 Zn finger 250..270 CDD:275368 8/19 (42%)
C2H2 Zn finger 306..326 CDD:275368 4/25 (16%)
C2H2 Zn finger 334..354 CDD:275368 3/21 (14%)
C2H2 Zn finger 361..382 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X96
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.