DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and AgaP_AGAP012834

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_306007.1 Gene:AgaP_AGAP012834 / 1267450 VectorBaseID:AGAP012834 Length:190 Species:Anopheles gambiae


Alignment Length:177 Identity:40/177 - (22%)
Similarity:70/177 - (39%) Gaps:43/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 DIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTHSNKKQVACFHCGELFRTKTTLFDH-LRR 226
            ::::..:.::.:.:|:  :|...|.   .::.|...||.::..:|.||....:.|:.:..| |..
Mosquito    18 EVRELGKKKKKRYLCD--ICGISMS---CILRHYDNHSEEQIHSCPHCPVKMKQKSNIAQHILTV 77

  Fly   227 QPENNTNSFQCAQCFKFFATKKLLKSHVVRHV---NCYKCTMCDMTCSSASSLTTHIRYRH---- 284
            ..:.||.  :||.|.|.|...|..:.|::.|.   ..::|..|:.|..:|..|..|....|    
Mosquito    78 HLKQNTR--KCAICGKGFIHHKTYRYHMLTHEGEGKKFECPDCEKTFPNAIYLRDHFNRLHNAAK 140

  Fly   285 ------------LKDKP-------------LKCSECDTRCVRESDLA 306
                        .|.||             |.||:|   |..|.:||
Mosquito   141 AAKKTQPAKKVRRKKKPAPNNGSIASDKHILICSKC---CSPEEELA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..225 CDD:275368 5/18 (28%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..311 CDD:275368 7/15 (47%)
C2H2 Zn finger 352..373 CDD:275368
AgaP_AGAP012834XP_306007.1 C2H2 Zn finger 32..49 CDD:275368 4/21 (19%)
C2H2 Zn finger 57..78 CDD:275368 6/20 (30%)
C2H2 Zn finger 86..106 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X96
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.