DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and PRDM5

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001366033.1 Gene:PRDM5 / 11107 HGNCID:9349 Length:641 Species:Homo sapiens


Alignment Length:444 Identity:98/444 - (22%)
Similarity:163/444 - (36%) Gaps:109/444 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KPAELE-----LTCGWRD---CQE-----ICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTEHQ 70
            |..|:|     .|.|.:|   |:|     .|...::....:.:||:               |.||
Human   142 KEGEVENSRRQSTAGRKDRLGCKEDYACPQCESSFTSEDILAEHLQ---------------TLHQ 191

  Fly    71 CTWNSCDFRTEN-------QVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPA 128
            ......:|:.:|       :...:||          :||             |||.:.|.|.   
Human   192 KPTEEKEFKCKNCGKKFPVKQALQRH----------VLQ-------------CTAKSSLKES--- 230

  Fly   129 LGQNFRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLI 193
             .::|:|  :.|...|.|...|:.|           |:|...: .:.:|....|.|.:.:|..|.
Human   231 -SRSFQC--SVCNSSFSSASSFEQH-----------QETCRGD-ARFVCKADSCGKRLKSKDALK 280

  Fly   194 EH---ISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVV 255
            .|   :.|...||::.|..|.:...:.::|.:| |:..|    .|.|.:|.|.|.:...||.|::
Human   281 RHQENVHTGDPKKKLICSVCNKKCSSASSLQEH-RKIHE----IFDCQECMKKFISANQLKRHMI 340

  Fly   256 RHVNC-------------YKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAK 307
            .|.:.             |.|.:|:.:......:..| :..|.:|||.||..|.......:....
Human   341 THSDMRLSPLIFLIEKRPYNCEICNKSFKRLDQVGAH-KVIHSEDKPYKCKLCGKGFAHRNVYKN 404

  Fly   308 HVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKK 372
            |.:....:...|||  :|....||...::||.| :| |:...:.||.|:..||...:|:.|:...
Human   405 HKKTHSEERPFQCE--ECKALFRTPFSLQRHLL-IH-NSERTFKCHHCDATFKRKDTLNVHVQVV 465

  Fly   373 HGFRLPSGHKRFTYRVDENGFYRLETTRLESLEVT--QQILSPQVNDSLAKPGT 424
            |     ..||::...:....|......|......|  ::.:.|......|..||
Human   466 H-----ERHKKYRCELCNKAFVTPSVLRSHKKTHTGEKEKICPYCGQKFASSGT 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 5/19 (26%)
C2H2 Zn finger 207..225 CDD:275368 4/17 (24%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..284 CDD:275368 3/20 (15%)
C2H2 Zn finger 292..311 CDD:275368 3/18 (17%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
PRDM5NP_001366033.1 PR-SET_PRDM5 2..128 CDD:380967
COG5048 <145..338 CDD:227381 55/253 (22%)
C2H2 Zn finger 169..190 CDD:275368 4/35 (11%)
C2H2 Zn finger 201..221 CDD:275368 5/42 (12%)
C2H2 Zn finger 236..256 CDD:275368 7/32 (22%)
COG5048 262..631 CDD:227381 64/268 (24%)
C2H2 Zn finger 264..287 CDD:275368 6/22 (27%)
C2H2 Zn finger 297..317 CDD:275368 5/20 (25%)
C2H2 Zn finger 322..342 CDD:275368 7/19 (37%)
C2H2 Zn finger 361..381 CDD:275368 3/20 (15%)
C2H2 Zn finger 389..409 CDD:275368 3/19 (16%)
C2H2 Zn finger 417..437 CDD:275368 8/22 (36%)
C2H2 Zn finger 445..462 CDD:275368 6/16 (38%)
C2H2 Zn finger 474..494 CDD:275368 2/19 (11%)
C2H2 Zn finger 502..522 CDD:275368 4/13 (31%)
C2H2 Zn finger 530..550 CDD:275368
C2H2 Zn finger 558..578 CDD:275368
C2H2 Zn finger 586..606 CDD:275368
C2H2 Zn finger 615..636 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.