DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and si:ch1073-127d16.1

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_021323944.1 Gene:si:ch1073-127d16.1 / 101883863 ZFINID:ZDB-GENE-120214-30 Length:454 Species:Danio rerio


Alignment Length:461 Identity:108/461 - (23%)
Similarity:161/461 - (34%) Gaps:125/461 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTEHQCTWNSCDFRTENQVEFERHSYYH--- 93
            |.| |...::|..::.:|::.:..|            |..|...||.....:...|.|...|   
Zfish    56 CAE-CGKSFTLKRYLKNHMKIHTGA------------HPFTCPECDKCFTMKHSLETHLKIHTGE 107

  Fly    94 ----------GYYLNLLLQGKLECDLHPEIPACTAPAR------LMEK------------LPALG 130
                      .:.|...|.|.|......:...|....|      :::|            .|..|
Zfish   108 KPFTCPDCGKKFRLKQSLDGHLRIHTGEKPYTCQVCGRSFREKQILDKHLTIHTGEKPYSCPECG 172

  Fly   131 QNFRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEH 195
            ::||.  .:|         .::||..|.           .|:|.| |.  .|.|....|..|..|
Zfish   173 KSFRV--KNC---------LENHIKIHT-----------GEKPYT-CQ--ECGKSFTEKQNLERH 212

  Fly   196 ISTHSNKKQVACFHCGELFRTKTTLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHV-- 258
            |..|:.:|..||..||..||.|..|..|||  .......|.|.||.|.|:..|.|::|:..|.  
Zfish   213 IRIHTGEKPFACPECGRSFRVKQDLKIHLR--IHTGEKPFSCQQCGKSFSENKKLENHMRIHTGE 275

  Fly   259 ------NC----------------------YKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSEC 295
                  :|                      |.|..|..:.:...||..||| .|..:||..|.:|
Zfish   276 KPFVCSHCGKNFRGKQNLESHMRLHTGNQPYTCPQCGKSYNQQKSLQIHIR-THTGEKPFACDQC 339

  Fly   296 DTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYACHCCERFFK 360
            .....::|.|..|::|...:....|  |.|..|....|::.|| .::|.... .|.|..|::.|.
Zfish   340 GKSFTQQSTLKGHIKIHTGEKPFTC--PQCGKSFIEKTKLERH-KKIHSGEK-AYTCQHCKKSFT 400

  Fly   361 SGKSLSAHLMKKHGFRLPSGHKRFTYRVDENGFYRLETTRLESLEVTQQILSPQVNDSLAKPGTG 425
            ..:||..|:      |:.:|.|.:|  ..:.|         :|....|::||.....:..||..|
Zfish   401 LKQSLDIHM------RIHTGEKLYT--CQQCG---------KSFTEKQKLLSHMTVHTEEKPALG 448

  Fly   426 SCYEIV 431
              .|:|
Zfish   449 --VEVV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..225 CDD:275368 8/17 (47%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
C2H2 Zn finger 263..284 CDD:275368 7/20 (35%)
C2H2 Zn finger 292..311 CDD:275368 5/18 (28%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
si:ch1073-127d16.1XP_021323944.1 COG5048 36..445 CDD:227381 103/450 (23%)
C2H2 Zn finger 56..76 CDD:275368 5/20 (25%)
C2H2 Zn finger 84..104 CDD:275368 4/19 (21%)
C2H2 Zn finger 112..132 CDD:275368 4/19 (21%)
C2H2 Zn finger 140..160 CDD:275368 3/19 (16%)
C2H2 Zn finger 168..188 CDD:275368 7/30 (23%)
C2H2 Zn finger 196..216 CDD:275368 7/21 (33%)
C2H2 Zn finger 224..244 CDD:275368 10/21 (48%)
C2H2 Zn finger 252..272 CDD:275368 8/19 (42%)
C2H2 Zn finger 280..300 CDD:275368 1/19 (5%)
C2H2 Zn finger 308..328 CDD:275368 7/20 (35%)
C2H2 Zn finger 336..356 CDD:275368 5/19 (26%)
C2H2 Zn finger 364..384 CDD:275368 7/22 (32%)
C2H2 Zn finger 392..412 CDD:275368 7/25 (28%)
C2H2 Zn finger 420..440 CDD:275368 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.