DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17829 and asb8

DIOPT Version :9

Sequence 1:	NP_652054.1	Gene:	CG17829 / 47718	FlyBaseID:	FBgn0025635	Length:	467	Species:	Drosophila melanogaster
Sequence 2:	XP_002932471.1	Gene:	asb8 / 100486931	XenbaseID:	XB-GENE-6049046	Length:	280	Species:	Xenopus tropicalis

Alignment Length:	109	Identity:	28/109 - (25%)
Similarity:	40/109 - (36%)	Gaps:	22/109 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   255 VRHVNCYKCTMCD---MTCSSASSLT-----------THIRYRHLKDKPL--KCSECDTRCVRES 303
            ::|.| .||:|.:   .|.||..||.           ..:...|....||  .|..||..||..
Frog     1 MQHFN-RKCSMPERLIRTISSIRSLPGDSVESLIRKGADVNCPHDTLMPLHSACMVCDPDCVEL- 63

  Fly   304 DLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNP 347
             |.::...|.|:..:|  ....||:...........:| :|.||
Frog    64 -LLENGAHVDSQDGYQ--RTALHYAAEKDVTCVEILIE-YGANP 103

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17829	NP_652054.1	C2H2 Zn finger	182..199	CDD:275368
		C2H2 Zn finger	207..225	CDD:275368
		C2H2 Zn finger	237..257	CDD:275368	0/1 (0%)
		C2H2 Zn finger	263..284	CDD:275368	7/34 (21%)
		C2H2 Zn finger	292..311	CDD:275368	6/18 (33%)
		C2H2 Zn finger	352..373	CDD:275368
asb8	XP_002932471.1	PHA02876	<27..>179	CDD:165207	18/82 (22%)
		ANK repeat	48..75	CDD:293786	10/28 (36%)
		ANK repeat	79..107	CDD:293786	6/26 (23%)
		ANK repeat	109..140	CDD:293786
		ANK repeat	142..173	CDD:293786
		SOCS	237..279	CDD:383010
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910