DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17829 and Ctcfl

DIOPT Version :9

Sequence 1:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001309415.1 Gene:Ctcfl / 100360757 RGDID:2321501 Length:645 Species:Rattus norvegicus


Alignment Length:365 Identity:85/365 - (23%)
Similarity:132/365 - (36%) Gaps:97/365 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AKAQDDRGAHAEHTEHQCTWNSCDFRTENQVEFERHSYYHG----YYLNLLLQGKLECDL---HP 111
            ||.:..|.........||  ::|.|.:.....|.||...|.    :..:|.|:......|   |.
  Rat   240 AKPKPQRQTKGRPRTFQC--DTCPFTSSKLSTFNRHIKIHSDERPHLCHLCLKSFRTVTLLRNHV 302

  Fly   112 EIPACTAPARLMEKLPALGQNFRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTM 176
            .....|.|             ::||  ||:..||:..|    :|:|..:::    |.|.....::
  Rat   303 NTHTGTRP-------------YKCG--DCDMAFVTSGE----LVRHRRYKH----THEKPFKCSL 344

  Fly   177 CNWAM---------CHKHMGNK--------------YRLIEHISTHSNKKQVACFHCGELFRTKT 218
            |.:|.         ...|.|.:              |:|..|:.|||.:|...|..|...|....
  Rat   345 CKYASVEASKLKRHIRSHTGERPFQCSQCAYASKDTYKLKRHMRTHSGEKPYECPTCHARFTQSG 409

  Fly   219 TLFDHLRRQPENNTNSFQCAQCFKFFATKKLLKSHVVRHVNCY-----KCTMCDMTCSSASSLTT 278
            |:..|:.::...|....:|..|....|.|..|:.| :|:::.:     ||..|........:|..
  Rat   410 TMKIHIAQKHGENVPKHECPHCATIIARKSDLRVH-LRNLHGHSPEEIKCRYCPAAFHERYALLQ 473

  Fly   279 HIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVH 343
            |.| .|..:|..||.:||..|.:|..|..|                    :||:|          
  Rat   474 HQR-THKNEKKFKCKQCDYACKQERCLTAH--------------------MRTHT---------- 507

  Fly   344 GNNPILYACHCCERFFKSGKSLSAHLMKKH--GFRLPSGH 381
            |..|  ::|..|.:.|:..:.|:.||.|.|  .| :||.|
  Rat   508 GERP--FSCLTCNKHFRQKQLLTVHLRKYHDPSF-VPSVH 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 5/30 (17%)
C2H2 Zn finger 207..225 CDD:275368 5/17 (29%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 292..311 CDD:275368 7/18 (39%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
CtcflNP_001309415.1 C2H2 Zn finger 257..277 CDD:275368 6/21 (29%)
C2H2 Zn finger 285..305 CDD:275368 4/19 (21%)
zf-H2C2_2 298..322 CDD:290200 8/38 (21%)
C2H2 Zn finger 313..334 CDD:275368 9/26 (35%)
COG5048 336..>398 CDD:227381 12/61 (20%)
C2H2 Zn finger 342..362 CDD:275368 2/19 (11%)
zf-H2C2_2 355..378 CDD:290200 2/22 (9%)
C2H2 Zn finger 370..390 CDD:275368 3/19 (16%)
zf-H2C2_2 383..407 CDD:290200 9/23 (39%)
C2H2 Zn finger 398..415 CDD:275370 4/16 (25%)
C2H2 Zn finger 428..451 CDD:275368 7/23 (30%)
C2H2 Zn finger 458..478 CDD:275368 5/20 (25%)
zf-H2C2_2 470..495 CDD:290200 10/25 (40%)
C2H2 Zn finger 486..506 CDD:275368 8/39 (21%)
zf-H2C2_2 499..523 CDD:290200 10/55 (18%)
C2H2 Zn finger 514..532 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.