DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NF2 and sstn

DIOPT Version :9

Sequence 1:NP_000259.1 Gene:NF2 / 4771 HGNCID:7773 Length:595 Species:Homo sapiens
Sequence 2:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster


Alignment Length:337 Identity:67/337 - (19%)
Similarity:128/337 - (37%) Gaps:77/337 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   267 SDKEFTIKPLDK-KIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKA 330
            |:|.:.::.:.| :..:...|...:.||:..:||.        ::.|.:    ||::|.|||..:
  Fly    75 SEKSWLLQQIQKQETAIINGNYEHMTVNEFFVQLA--------QQYKHE----QQLQALARENSS 127

Human   331 ---RKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITE 392
               |||....|.:|:.||.......:.|            |::|    ||.| .|.....:....
  Fly   128 ILRRKQSTTSRESRDSQMTINNNNRQSE------------TLSN----RSSE-YDNYQPSSSAGA 175

Human   393 EEAKLLAQKAAEAEQEMQRIKATAIR----TEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQ 453
            .:..::.....:|:|:...:|:...:    |..:.:.|.|:..:...||:.|    ..:..:.|.
  Fly   176 GDMLVIGVAQQQAQQQPPLVKSALKKRPTPTPSQMQYMRQQHQQQAHLAMNM----NYQRSQPDV 236

Human   454 LKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAP---------LPPDIPSFNLIGDSLSFDF 509
            :  .:..|..:         .:||....|.:.|...|         |.|...|:|..|    |..
  Fly   237 I--SMYSANSS---------NVATLRQPPQVAPQQQPIIVQCDKYYLSPTHQSYNEGG----FIK 286

Human   510 KDTDMKR-LSMEIEKEKVEYMEKSKHLQEQLNEL--KTEIEALKLKERETALDI--LHNENSDRG 569
            ...::|: :|.......:.|.:     |:|.|.|  :.:::|:.|.....::|:  ..::...|.
  Fly   287 SSQNIKKYVSPMASPSNISYEQ-----QQQRNPLHHQRQLDAISLAPSYVSVDMEAAQHQQQYRW 346

Human   570 GSSKHNTIKKLT 581
            .|..|  |..||
  Fly   347 RSQSH--IAPLT 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NF2NP_000259.1 B41 23..222 CDD:214604
FERM_C_ERM 216..312 CDD:270015 8/45 (18%)
PLN03086 307..>367 CDD:178635 15/62 (24%)
ERM 347..595 CDD:366293 45/253 (18%)
sstnNP_648745.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.