DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NF2 and Moe

DIOPT Version :10

Sequence 1:NP_000259.1 Gene:NF2 / 4771 HGNCID:7773 Length:595 Species:Homo sapiens
Sequence 2:NP_727290.1 Gene:Moe / 31816 FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster


Alignment Length:244 Identity:45/244 - (18%)
Similarity:66/244 - (27%) Gaps:109/244 - (44%)


- Green bases have known domain annotations that are detailed below.


Human     9 ESFSHQCLPVEAQPERESQNLLEENALPVLQVSSVPLKDSQELTDSLLSDGPQKLVKTEDVADVA 73
            :||...|.|       |..|.::...|.:|...|...||.:.|....|....|.....|.:.|:.
  Fly   110 KSFREYCTP-------EDLNSVDPGLLILLSDISKGTKDCEMLYPFFLDHAKQVFPHLEAMDDLR 167

Human    74 VSFILEEWAHLDQSQKSLGRDSRKEDCESTTPVDYEPKEGNLEFTVQQVSDAADPH-WVAAERTE 137
            :                                               :||...|| |.      
  Fly   168 I-----------------------------------------------ISDLTRPHNWY------ 179

Human   138 KNGVQRPESGEVSDLKDMVPRWQVNPTSGNPRQKRPLRSGPDVNRKQKSNGERGH---RCGD--- 196
                  ||:..|:                   :|....:||      .::|:..|   |.|:   
  Fly   180 ------PEARSVT-------------------RKIFFHAGP------TNSGKTYHALKRFGEAKS 213

Human   197 ---CGKFFLQASNFIQHRRIHTGEKPFKC----GECGKSYNQRVHLTQH 238
               ||...|.|:. :.||   |.|....|    ||..:......|.:||
  Fly   214 AVFCGPLKLLAAE-VFHR---TNELGIPCDLVTGEERRFAKDNHHPSQH 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NF2NP_000259.1 B41 23..222 CDD:214604 35/208 (17%)
FERM_C_ERM 216..312 CDD:270015 7/27 (26%)
PLN03086 307..>367 CDD:178635
ERM_helical 346..465 CDD:466641
ERM_C 518..595 CDD:459932
MoeNP_727290.1 B41 26..278 CDD:214604 45/244 (18%)
FERM_C_ERM 272..368 CDD:270015
ERM_helical 402..521 CDD:466641
ERM_C 573..649 CDD:459932
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.