DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEUROG1 and tap

DIOPT Version :9

Sequence 1:NP_006152.2 Gene:NEUROG1 / 4762 HGNCID:7764 Length:237 Species:Homo sapiens
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:300 Identity:92/300 - (30%)
Similarity:118/300 - (39%) Gaps:102/300 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    15 ASSSGSDLSGFLTDEEDCA-------------------RLQ------------------QAASAS 42
            |.|:||....|..|::|.:                   ||.                  .|...|
  Fly     7 AYSAGSQSFEFDEDDDDASFDSGYEKSFETEAQLSSRRRLDFGTPPTPAIPQPYSGGTWDAVPLS 71

Human    43 GPPA------------PARRGAPNI----SRASE-----------VPGAQDDEQERRRRR---GR 77
            .|||            ..|.|...:    |||:.           |...:|....|.:|:   |:
  Fly    72 SPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGK 136

Human    78 TRV---RSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYN 139
            .||   ||...:..::|.||:||||||||||||||.||:.||..|||.|::|||||||.||||:|
  Fly   137 NRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHN 201

Human   140 YIWALAETL-----------RLADQGLPGGGARERL-----LPPQCVPCLPGPPSPASDAESWGS 188
            ||:||.:.|           :|.:..|.|....:.|     :.||..| |.|...|      :|.
  Fly   202 YIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYP-LFGRMFP------YGQ 259

Human   189 GAA-----AASPLSDPSSPAASEDF----TYRPGDPVFSF 219
            |.|     ..:|.|....|.|...|    .|....|.|.|
  Fly   260 GMAPLAQHQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEUROG1NP_006152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..83 19/98 (19%)
HLH 90..149 CDD:238036 42/69 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..209 10/42 (24%)
tapNP_524124.1 HLH 155..207 CDD:278439 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145406
Domainoid 1 1.000 81 1.000 Domainoid score I8498
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002069
OrthoInspector 1 1.000 - - otm42278
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4181
SonicParanoid 1 1.000 - - X1366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.