DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEUROG1 and HLH54F

DIOPT Version :10

Sequence 1:NP_006152.2 Gene:NEUROG1 / 4762 HGNCID:7764 Length:237 Species:Homo sapiens
Sequence 2:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster


Alignment Length:49 Identity:25/49 - (51%)
Similarity:34/49 - (69%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    93 RRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYI 141
            :|..||.|||.||..|::|...|::.||:.|.||||:|::|||.|..||
  Fly    32 QRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYI 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEUROG1NP_006152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..83
bHLH_TS_NGN1_NeuroD3 82..153 CDD:381559 25/49 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..209
HLH54FNP_477302.1 bHLH_TS_musculin_like 32..87 CDD:381429 25/49 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.