DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEUROG1 and dimm

DIOPT Version :9

Sequence 1:NP_006152.2 Gene:NEUROG1 / 4762 HGNCID:7764 Length:237 Species:Homo sapiens
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:190 Identity:64/190 - (33%)
Similarity:86/190 - (45%) Gaps:33/190 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    18 SGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQERRRRRGRTRVRS 82
            ||..|.|  .......|:|||:|.:.|...    ||| |.:|....|..:..  |||:|      
  Fly    98 SGCSLGG--QGPSGRGRVQQASSGACPSTI----APN-STSSNSSNANGNAS--RRRKG------ 147

Human    83 EALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWAL--- 144
             ||....|..||:::|:|||.|||:||.|..:||.|:|....:.:|:|||||..|.|||..|   
  Fly   148 -ALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHI 211

Human   145 --------AETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDA-----ESWGSGAA 191
                    |..|.| :.|..||.....|......|...|.|:.::.|     ::..||.|
  Fly   212 ILSKRNEEAAALEL-NSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFEDTLASGGA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEUROG1NP_006152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..83 15/47 (32%)
HLH 90..149 CDD:238036 29/69 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..209 6/22 (27%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.