DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEUROG1 and Hand

DIOPT Version :10

Sequence 1:NP_006152.2 Gene:NEUROG1 / 4762 HGNCID:7764 Length:237 Species:Homo sapiens
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:75 Identity:33/75 - (44%)
Similarity:42/75 - (56%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    93 RRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGL-P 156
            :|..||.:||.|..::|.|...||..:|:.|.||||:||:||:.|..||..|...|   |..| |
  Fly    59 KRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL---DGDLDP 120

Human   157 GGGARERLLP 166
            .||.|..|.|
  Fly   121 KGGFRAELKP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEUROG1NP_006152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..83
bHLH_TS_NGN1_NeuroD3 82..153 CDD:381559 25/59 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..209
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 24/54 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.