DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEUROG1 and Fer1

DIOPT Version :10

Sequence 1:NP_006152.2 Gene:NEUROG1 / 4762 HGNCID:7764 Length:237 Species:Homo sapiens
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:187 Identity:37/187 - (19%)
Similarity:68/187 - (36%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   886 ISNEFVVLLDLRTKEVVFNCYCGD--------VIGWTPDSSTIKIFYGRGDHIF------LQAAE 936
            :.||..|||.|:...:| ..|..:        ::.:.|......  |.|....|      ..|:|
  Fly    62 VHNEKRVLLQLKHPFIV-KMYASEKDSNHLYMIMEFVPGGEMFS--YLRASRSFSNSMARFYASE 123

Human   937 GSVEDIRDIVQRLKVMTNGWETVDMTLRRNGLGQLGFHVKYDGTVAEVEDYGFAWQAGLRQGSRL 1001
              :....:.:..|.::....:..::.|.:.|      |:|       :.|:|||.:  ||  .|.
  Fly   124 --IVCALEYIHSLGIVYRDLKPENLMLSKEG------HIK-------MADFGFAKE--LR--DRT 169

Human  1002 VEICKV-------AVVTLSHDQMIDLLRTSVTVKVVII--PPFEDGTPRRGWPETYD 1049
            ..||..       ::....|::.:|.....:.:..:::  |||...|.    .|.||
  Fly   170 YTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMMVGKPPFRGKTT----SEIYD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEUROG1NP_006152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..83
bHLH_TS_NGN1_NeuroD3 82..153 CDD:381559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..209
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 7/58 (12%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.