DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEUROD2 and Fer3

DIOPT Version :9

Sequence 1:NP_006151.3 Gene:NEUROD2 / 4761 HGNCID:7763 Length:382 Species:Homo sapiens
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:241 Identity:62/241 - (25%)
Similarity:90/241 - (37%) Gaps:84/241 - (34%)


- Green bases have known domain annotations that are detailed below.


Human     8 EPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVP----LRGEEGTEA 68
            :|..:.|||....||.           :|||||                .||    :.|...|:.
  Fly     9 QPTYMPDVPFQPLWGQ-----------EAPPPP----------------IVPYQELIAGFPCTDL 46

Human    69 TLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRG-----PKKRKMTKARLERSKLRRQKANA 128
            :|.:..:...|                 ..:||...|     ....|.|:.|: .|..:|:.||.
  Fly    47 SLWQRSQVTPL-----------------VPQRPSTNGRANGSSSSSKKTRRRV-ASMAQRRAANI 93

Human   129 RERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLC 193
            |||.||.:||.|.|.||:.||.::..::||:|||||||..||..::|:| ||             
  Fly    94 RERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELL-SG------------- 144

Human   194 KGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPY 239
                            ..|.:..:.....|:...|....|.|:||:
  Fly   145 ----------------TPSNSHKSRSDVYGSMNGHHQAPPPAIHPH 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEUROD2NP_006151.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 27/129 (21%)
bHLH_TS_NeuroD2 88..180 CDD:381563 36/96 (38%)
Nuclear localization signal. /evidence=ECO:0000255 107..113 1/5 (20%)
Neuro_bHLH 180..310 CDD:403655 8/60 (13%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 25/47 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.