DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEUROD1 and Fer3

DIOPT Version :9

Sequence 1:NP_002491.3 Gene:NEUROD1 / 4760 HGNCID:7762 Length:356 Species:Homo sapiens
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:193 Identity:54/193 - (27%)
Similarity:74/193 - (38%) Gaps:74/193 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    79 QKPKRRG-----PKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLS 138
            |:|...|     ....|.|:.|:.....|| .||.|||.||..||.|.|.||:.||.::..::||
  Fly    60 QRPSTNGRANGSSSSSKKTRRRVASMAQRR-AANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLS 123

Human   139 KIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDM 203
            :|||||||..||..::|:| ||...:                                       
  Fly   124 RIETLRLAITYIGFMAELL-SGTPSN--------------------------------------- 148

Human   204 PPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPP-----HAY-SAALEPFFESP 260
                            |::|   .|..||:|:.   .|..|||     |.: :||.:..|.||
  Fly   149 ----------------SHKS---RSDVYGSMNG---HHQAPPPAIHPHHLHPAAAYQRDFASP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEUROD1NP_002491.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 5/19 (26%)
bHLH_TS_NeuroD1 75..160 CDD:381562 36/85 (42%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 1/5 (20%)
Neuro_bHLH 160..284 CDD:403655 17/107 (16%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 26/48 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.