DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and WAG1

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_175774.1 Gene:WAG1 / 841807 AraportID:AT1G53700 Length:476 Species:Arabidopsis thaliana


Alignment Length:372 Identity:111/372 - (29%)
Similarity:165/372 - (44%) Gaps:83/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 LNDFELIRVIGRGSYAKVLMVELRRTRRI--YAMKVIKKALVTDDEDIDWVQTEKHVFETASNHP 675
            |..|:|:|.:|.|:..:|.:..||.....  :|:|||.:.::| .:.|..|:||..:. :..:||
plant    90 LRHFKLVRHLGTGNLGRVFLCHLRDCPNPTGFALKVIDRDVLT-AKKISHVETEAEIL-SLLDHP 152

  Fly   676 FLVGLHSCFQTPSRLFFVIEFVRGGDL--MYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIY 738
            ||..|::..........:|::...|||  :...|...|||....||:|||:.:||.:||..||:|
plant   153 FLPTLYARIDASHYTCLLIDYCPNGDLHSLLRKQPNNRLPISPVRFFAAEVLVALEYLHALGIVY 217

  Fly   739 RDLKLDNVLLDHEGHIKLTDYGMC--------------------------------------KEG 765
            ||||.:|:|:..:|||.|:|:.:|                                      :|.
plant   218 RDLKPENILIREDGHIMLSDFDLCFKADVVPTFRSRRFRRTSSSPRKTRRGGGCFSTEVEYEREE 282

  Fly   766 I------RPGDTTSTFC-GTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASEN 823
            |      .|....|..| ||..|:|||::.|..:|..|||||.|:.|||||.|.:||. .|..|.
plant   283 IVAEFAAEPVTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLYGTTPFK-GGTKEQ 346

  Fly   824 PDQN---TEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFK 885
            ..:|   .:|..|.:..|.        .|.|..:::..|.|:|..||||.|.:  .||..|.||:
plant   347 TLRNIVSNDDVAFTLEEEG--------MVEAKDLIEKLLVKDPRKRLGCARGA--QDIKRHEFFE 401

  Fly   886 NMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLTPDDDHV 932
            .:.|.|:...:                  |||..|...:......||
plant   402 GIKWPLIRNYK------------------PPEIRGLVKKTKAHAGHV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 100/319 (31%)
STKc_aPKC 620..947 CDD:270740 108/365 (30%)
WAG1NP_175774.1 STKc_phototropin_like 91..416 CDD:270726 106/355 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.