DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and D6PK

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_001332267.1 Gene:D6PK / 835689 AraportID:AT5G55910 Length:498 Species:Arabidopsis thaliana


Alignment Length:418 Identity:124/418 - (29%)
Similarity:189/418 - (45%) Gaps:110/418 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 LNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFL 677
            ||.|.|::.:|.|....|.:.||..||..:||||:.|..:...:.:...|||:.:.: ..:||||
plant   106 LNHFRLLKRLGCGDIGTVHLAELNGTRCYFAMKVMDKTALASRKKLLRAQTEREILQ-CLDHPFL 169

  Fly   678 VGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQ--RRLPEEHARFYAAEISLALNFLHEKGIIYRD 740
            ..|:|.|:|......|:||..||||....|||  :|..|:.|:||.||:.||:.:||..||||||
plant   170 PTLYSHFETEKFSCLVMEFCPGGDLHTLRQRQPGKRFTEQAAKFYVAEVLLAMEYLHMLGIIYRD 234

  Fly   741 LKLDNVLLDHEGHIKLTDY---------------------GMCKEGI------------------ 766
            ||.:|||:..:||:.|:|:                     |:.|..:                  
plant   235 LKPENVLVRDDGHVMLSDFDLSLRCTVSLSIVRSANVGSEGLSKNSVSCSQQPACIQQPSCISMA 299

  Fly   767 ------------------RP--------------------GDTTSTFCGTPNYIAPEILRGEDYG 793
                              :|                    |..:.:|.||..|:||||::||.:|
plant   300 PTSCFGPRFFSSKSKKDKKPKTENGNHQVTPLPELVAEPTGARSMSFVGTHEYLAPEIIKGEGHG 364

  Fly   794 FSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRS--LSVRAASVLK 856
            .:||||..|:.|||:|.|::||..:|        ....||.|: .:.:|.|.|  :|..|..:::
plant   365 SAVDWWTFGIFLYELLFGKTPFKGSG--------NRATLFNVV-GQPLRFPESPVVSFAARDLIR 420

  Fly   857 GFLNKNPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGE 921
            ..|.|.|..||...|.:.  :|..||||:.::|.|:  :..:||..|:          |.:.  |
plant   421 SLLVKEPQHRLAYKRGAT--EIKQHPFFEGVNWALV--RCASPPEIPK----------PVDL--E 469

  Fly   922 AVQLTPDDDHVIDN---IDQSEFEGFEY 946
            |:..||.......:   .|||.:..|::
plant   470 ALNPTPTVPAAASSSVRSDQSNYLEFDF 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 106/348 (30%)
STKc_aPKC 620..947 CDD:270740 120/411 (29%)
D6PKNP_001332267.1 STKc_phototropin_like 108..470 CDD:270726 114/387 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.