DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and AT5G40030

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_198819.1 Gene:AT5G40030 / 834000 AraportID:AT5G40030 Length:499 Species:Arabidopsis thaliana


Alignment Length:368 Identity:116/368 - (31%)
Similarity:177/368 - (48%) Gaps:93/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 LNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFL 677
            |..|.|::.:|.|....|.:.|||.....:||||:.|.::...:.:...|||:.:.... :||||
plant   111 LGHFRLLKKLGCGDIGSVYLAELREMGCFFAMKVMDKGMLIGRKKLVRAQTEREILGLL-DHPFL 174

  Fly   678 VGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEH-----ARFYAAEISLALNFLHEKGII 737
            ..|:|.|:|......::||..||||  |:.||:: |.:|     |||||:|:.|||.:||..|::
plant   175 PTLYSHFETEKFSCLLMEFCSGGDL--HILRQKQ-PGKHFSELAARFYASEVLLALEYLHMMGVV 236

  Fly   738 YRDLKLDNVLLDHEGHIKLTDYGM----------------------------------CKEGI-- 766
            |||||.:||::..:|||.|:|:.:                                  ||..:  
plant   237 YRDLKPENVMVREDGHIMLSDFDLSLQSFVSPTLIQSTSQPSCHIASYCIQPPCIDPSCKLPVAC 301

  Fly   767 ---------------RPGDT-------------------TSTFCGTPNYIAPEILRGEDYGFSVD 797
                           |...|                   :.:|.||..|:||||:||:.:|.|||
plant   302 IQPSCFKPRFLNNKPRKAKTEKAGSDSLPMLIAEPTAARSMSFVGTHEYLAPEIIRGDGHGSSVD 366

  Fly   798 WWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPR-SLSVRAASVLKGFLNK 861
            ||..|:.|||:|.|::||...|..|.        ||.|: .:.::.|. |:|..|..:::|.|.|
plant   367 WWTFGIFLYELLTGKTPFKGNGNRET--------LFNVV-GQPLKFPEGSISFAAKDLIRGLLTK 422

  Fly   862 NPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPR 904
            :|..|||..:.:.  :|..||||.|::|.|:  :..|||..|:
plant   423 DPKKRLGFKKGAT--EIKQHPFFNNVNWALI--RSTTPPEIPK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 106/343 (31%)
STKc_aPKC 620..947 CDD:270740 113/361 (31%)
AT5G40030NP_198819.1 STKc_phototropin_like 113..464 CDD:270726 115/366 (31%)
Keratin_B2_2 276..>309 CDD:372783 2/32 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.