DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and D6PKL1

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_194391.1 Gene:D6PKL1 / 828768 AraportID:AT4G26610 Length:506 Species:Arabidopsis thaliana


Alignment Length:411 Identity:122/411 - (29%)
Similarity:186/411 - (45%) Gaps:102/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 LNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFL 677
            ||.|.|::.:|.|....|.:.||..||..:||||:.|..:...:.:...|||:.:.: ..:||||
plant   120 LNHFRLLKRLGCGDIGTVHLAELHGTRCFFAMKVMDKGALASRKKLLRAQTEREILQ-CLDHPFL 183

  Fly   678 VGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQ--RRLPEEHARFYAAEISLALNFLHEKGIIYRD 740
            ..|:|.|:|......|:||..||||....|||  :|..|:.|:||.||:.||:.:||..||||||
plant   184 PTLYSHFETEKFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLHMLGIIYRD 248

  Fly   741 LKLDNVLLDHEGHIKLTDY--------------------------GMCKE--------------- 764
            ||.:|||:..:||:.|:|:                          |.|.:               
plant   249 LKPENVLVRDDGHVMLSDFDLSLRCTVSPTVVRSTVLASEGQKNSGYCAQPACIQQPSCISAPTT 313

  Fly   765 -----------------------GIRP-----GDTTS----TFCGTPNYIAPEILRGEDYGFSVD 797
                                   .:.|     .:.||    :|.||..|:||||::||.:|.:||
plant   314 CFSPRYFSSKSKKDKKMKNETGNQVSPLPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVD 378

  Fly   798 WWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRS--LSVRAASVLKGFLN 860
            ||..|:.|||:|.|::||..:|        ....||.|: .:.:|.|.|  :|..|..:::..|.
plant   379 WWTFGIFLYELLFGKTPFKGSG--------NRATLFNVV-GQPLRFPESPVVSFAARDLIRSLLV 434

  Fly   861 KNPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQL 925
            |.|..||...|.:.  ::..||||:.::|.|:  :..:||..|:..........|...|..:|: 
plant   435 KEPQHRLAYKRGAT--EMKQHPFFEGVNWALV--RCASPPEIPKPVDYESAPATPAAATSTSVK- 494

  Fly   926 TPDDDHVIDNIDQSEFEGFEY 946
                      .|||.:..|::
plant   495 ----------SDQSNYLEFDF 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 106/344 (31%)
STKc_aPKC 620..947 CDD:270740 118/404 (29%)
D6PKL1NP_194391.1 STKc_phototropin_like 122..477 CDD:270726 113/368 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.