DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and ATPK7

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_001030784.1 Gene:ATPK7 / 822380 AraportID:AT3G27580 Length:578 Species:Arabidopsis thaliana


Alignment Length:370 Identity:119/370 - (32%)
Similarity:175/370 - (47%) Gaps:93/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 DFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVG 679
            ||:||:.:|.|....|.:.||..|...:|:||::||.:...:.:...||||.:.::. :||||..
plant   181 DFKLIKKLGGGDIGNVYLAELIGTGVSFAVKVMEKAAIAARKKLVRAQTEKEILQSL-DHPFLPT 244

  Fly   680 LHSCFQTPSRLFFVIEFVRGGDL--MYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLK 742
            |:|.|:|......|:||..||||  :...||.:..||:.||||.||:.||:.:||..||||||||
plant   245 LYSHFETEMNSCLVMEFCPGGDLHSLRQKQRGKYFPEQAARFYVAEVLLAMEYLHMLGIIYRDLK 309

  Fly   743 LDNVLLDHEGHIKLTDYGM---------------------------------------------- 761
            .:|||:..:|||.|:|:.:                                              
plant   310 PENVLVREDGHIMLSDFDLSLRCAVSPTLVRFAAITLESKSSSYCIQPTCVDQSSCIVQPDCIQP 374

  Fly   762 -C------------------KEGIRP-----GDTTS----TFCGTPNYIAPEILRGEDYGFSVDW 798
             |                  ...|||     .:.||    :|.||..|:||||::||.:|.:|||
plant   375 VCFTPRFLSKGKHRKKSNDMSRQIRPLPELIAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDW 439

  Fly   799 WALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPR--SLSVRAASVLKGFLNK 861
            |..|:.|||:|.|.:||      ...|....  ||.|: .:.:|.|.  ::|..|..:::|.|.|
plant   440 WTFGIFLYELLFGITPF------RGGDNRAT--LFNVV-GQPLRFPEHPNVSFAARDLIRGLLVK 495

  Fly   862 NPADRLGCHRESAFMDIVSHPFFKNMDWELL---ERKQVTPPFKP 903
            .|..||...|.:.  :|..||||::::|.|:   ...|:..|.||
plant   496 EPQHRLAYRRGAT--EIKQHPFFQSVNWALIRCTSPPQIPQPVKP 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 110/345 (32%)
STKc_aPKC 620..947 CDD:270740 115/365 (32%)
ATPK7NP_001030784.1 STKc_phototropin_like 180..540 CDD:270726 119/370 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.