DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and PID

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_181012.1 Gene:PID / 818030 AraportID:AT2G34650 Length:438 Species:Arabidopsis thaliana


Alignment Length:408 Identity:122/408 - (29%)
Similarity:188/408 - (46%) Gaps:96/408 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   578 MSGGAEACETHDHAHIVAPP---PPED---PLEPGTQRQY-------------SLNDFELIRVIG 623
            :|.|.|:|.:.......|||   |.|:   .|:|.....:             :..||.|:|.||
plant    18 ISSGTESCSSFSRLSFDAPPSTIPEEESFLSLKPHRSSDFAYAEIRRRKKQGLTFRDFRLMRRIG 82

  Fly   624 RGSYAKVLMVEL----RRTRRIY-AMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSC 683
            .|....|.:..|    ..:|..| ||||:.|..:...:.:...:.||.:.:.. :||||..|::.
plant    83 AGDIGTVYLCRLAGDEEESRSSYFAMKVVDKEALALKKKMHRAEMEKTILKML-DHPFLPTLYAE 146

  Fly   684 FQTPSRLFFVIEFVRGGDL--MYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNV 746
            |:.......|:|:..||||  :.|.|..||.....|||||||:.:||.:||..||||||||.:|:
plant   147 FEASHFSCIVMEYCSGGDLHSLRHRQPHRRFSLSSARFYAAEVLVALEYLHMLGIIYRDLKPENI 211

  Fly   747 LLDHEGHIKLTDY--GMCKEGIRPGDTTS------------------------------------ 773
            |:..:|||.|:|:  .:|.:.|...:::|                                    
plant   212 LVRSDGHIMLSDFDLSLCSDSIAAVESSSSSPENQQLRSPRRFTRLARLFQRVLRSKKVQTLEPT 276

  Fly   774 -------------TFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPD 825
                         :|.||..|:|||:..|..:|.:|||||.||.||||:.|::||...       
plant   277 RLFVAEPVTARSGSFVGTHEYVAPEVASGGSHGNAVDWWAFGVFLYEMIYGKTPFVAP------- 334

  Fly   826 QNTEDYLFQVILEKTIRIPRS-----LSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFK 885
              |.|.:.:.|:::.:..|..     ..:.|.:::.|.|||:|..|||..|.:|  ::..|||||
plant   335 --TNDVILRNIVKRQLSFPTDSPATMFELHARNLISGLLNKDPTKRLGSRRGAA--EVKVHPFFK 395

  Fly   886 NMDWELLERKQVTPPFKP 903
            .:::.|:  :.:|||..|
plant   396 GLNFALI--RTLTPPEIP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 102/330 (31%)
STKc_aPKC 620..947 CDD:270740 108/347 (31%)
PIDNP_181012.1 STKc_phototropin_like 73..411 CDD:270726 110/351 (31%)
S_TKc 75..394 CDD:214567 102/330 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.