DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and si:ch211-195b13.1

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_001070770.2 Gene:si:ch211-195b13.1 / 768159 ZFINID:ZDB-GENE-030131-7626 Length:423 Species:Danio rerio


Alignment Length:416 Identity:159/416 - (38%)
Similarity:234/416 - (56%) Gaps:44/416 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   555 VKERAEESSDPIP--VPLPPLPYEAMSGG--------------AEACETHDHAHIVAPPPPEDPL 603
            :|||....:|.|.  |..||:...|..|.              ...|.||          |...|
Zfish    26 IKERKMGLNDFIQRLVSNPPICQHADVGSFLKIDENQNEELDENLLCLTH----------PRSSL 80

  Fly   604 EPGTQRQYSLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVF 668
            ...||.:.|  ||:.:::||:||:.|||:...:.....||:||::|.::...::...:..|:.|.
Zfish    81 AEETQIKPS--DFDYLKIIGKGSFGKVLLARHKENELYYAVKVLQKKIIMKKKEQKHIMAERSVL 143

  Fly   669 ETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHE 733
            .....||||||||..|||..:|:||:::|.||:|.||:||:|...|..||||||||:.||.:||.
Zfish   144 MKNIKHPFLVGLHYSFQTTDKLYFVLDYVNGGELFYHLQRERVFLEPRARFYAAEIASALGYLHS 208

  Fly   734 KGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDW 798
            ..|:|||||.:|:|||.:|||.|||:|:||||:.|..||:||||||.|:|||:|:.:.|..:|||
Zfish   209 LHIVYRDLKPENILLDSQGHIVLTDFGLCKEGLDPNGTTTTFCGTPEYLAPEVLQKQAYDRTVDW 273

  Fly   799 WALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNP 863
            |.||.:|:|||.|..||        ..:||.: ::..||.|.:.:..::|.....:|:|.|:|:.
Zfish   274 WCLGSVLFEMLYGLPPF--------YSRNTAE-MYNNILHKPLVLKPNVSNAGRDLLEGLLHKDR 329

  Fly   864 ADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLT-- 926
            ..|||  .:..|:::..|.||..::|:.|..|::.|||.|.:....||.:|.||||...|..:  
Zfish   330 TKRLG--SKDDFLELKFHSFFSPINWDDLMAKRIVPPFIPTVTGPTDLRHFDPEFTHLPVSTSLC 392

  Fly   927 -PDDDHVIDNIDQS--EFEGFEYVNP 949
             .|:.||..::.::  .|.||.|..|
Zfish   393 NTDNLHVTSSVREAAGAFPGFSYGPP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 115/267 (43%)
STKc_aPKC 620..947 CDD:270740 137/331 (41%)
si:ch211-195b13.1NP_001070770.2 S_TKc 91..348 CDD:214567 115/267 (43%)
STKc_SGK 95..415 CDD:270727 137/330 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.