DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and PRKCH

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_006246.2 Gene:PRKCH / 5583 HGNCID:9403 Length:683 Species:Homo sapiens


Alignment Length:534 Identity:227/534 - (42%)
Similarity:307/534 - (57%) Gaps:75/534 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 RRGARRWRKLYRVNGHIFQAKRFNRRAFCAYCQDRIWGL-GRQGFKCIQCKLLVHKKCHKLVQKH 546
            |:.|.| |:::::|||.|.|....:..:|::|::.|||: |:||::|..|..:|||:||.|:...
Human   158 RQRAMR-RRVHQINGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTA 221

  Fly   547 CTDQPE-PLVKERAEESSDPIPVP---------LP-------PLPYEAMSGGAEA--CETHDHAH 592
            ||.|.. ..|..:..|....|.:|         :|       .|.:..|..|.:.  |:.:.|..
Human   222 CTCQNNINKVDSKIAEQRFGINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIR 286

  Fly   593 IVAPPPPE--------------DPLEPG-------------------------------TQRQYS 612
            ..|...|.              ..|:||                               :..:..
Human   287 CQANVAPNCGVNAVELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLG 351

  Fly   613 LNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFL 677
            :::||.|||:|:||:.||::..::.|..:||:||:||.::..|:|::...|||.:...|.|||||
Human   352 IDNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFL 416

  Fly   678 VGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLK 742
            ..|..|||||.|||||:|||.|||||:|:|:.||..|..||||||||..||.|||:|||||||||
Human   417 TQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDLK 481

  Fly   743 LDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYE 807
            |||||||||||.||.|:|||||||..|.||:||||||:|||||||:...||.:|||||:||||||
Human   482 LDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAMGVLLYE 546

  Fly   808 MLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRE 872
            ||.|.:||:    :||     ||.||:.||...:..|..|...|..:||.|:.|||..|||...:
Human   547 MLCGHAPFE----AEN-----EDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQ 602

  Fly   873 SAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLTPDDDHVIDNID 937
            .....|:.|||||.:||..|..:|:.|||:||:.|..|::||.|:|..|...|||.|:..:..|:
Human   603 GGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMIN 667

  Fly   938 QSEFEGFEYVNPLL 951
            |.||..|.||:|.|
Human   668 QDEFRNFSYVSPEL 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556 21/52 (40%)
S_TKc 616..884 CDD:214567 152/267 (57%)
STKc_aPKC 620..947 CDD:270740 177/326 (54%)
PRKCHNP_006246.2 C2_PKC_epsilon 8..140 CDD:175981
C1_1 172..225 CDD:278556 21/52 (40%)
C1_1 246..298 CDD:278556 8/51 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..342 0/21 (0%)
S_TKc 355..614 CDD:214567 152/267 (57%)
STKc_nPKC_eta 359..681 CDD:270742 180/330 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D222529at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.