DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and gwl

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_524860.2 Gene:gwl / 45969 FlyBaseID:FBgn0260399 Length:846 Species:Drosophila melanogaster


Alignment Length:157 Identity:57/157 - (36%)
Similarity:97/157 - (61%) Gaps:2/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   612 SLNDFELIRVIGRGSYAKVLM-VELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHP 675
            ::.||.:|:.|.||::.||.: .:...::|::|:||::|:.:.:...:..|.||::.. ..|...
  Fly    53 TIKDFVIIKPISRGAFGKVFLGYKNNDSKRLFAIKVMRKSEMINKNMVSQVITERNAL-ALSRSQ 116

  Fly   676 FLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRD 740
            |.|.|....|:.|.::.|:|::.||||...:.......|..||||.||:.:||.:||:.||::||
  Fly   117 FCVSLFYSLQSLSYVYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIVHRD 181

  Fly   741 LKLDNVLLDHEGHIKLTDYGMCKEGIR 767
            :|.||:||...||:||||:|:.|..:|
  Fly   182 IKPDNMLLSSSGHVKLTDFGLSKIDMR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 56/153 (37%)
STKc_aPKC 620..947 CDD:270740 54/149 (36%)
gwlNP_524860.2 STKc_MASTL 52..>255 CDD:270761 57/157 (36%)
S_TKc 57..>205 CDD:214567 54/148 (36%)
PKc_like <655..835 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.