DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and CG32944

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster


Alignment Length:499 Identity:124/499 - (24%)
Similarity:201/499 - (40%) Gaps:106/499 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 MGVAPSSQQMSQHQLQSEEEIEPAYATVFP--------NVPQAPGLSCDGED-RSIYRRGARRWR 490
            :|:.....|::  .:||.|...|...:::.        |:.:.|.|   |:| |.:.....::..
  Fly    13 LGLLELPDQIA--MMQSYERCRPLLGSIWRHRLTRISLNLLEIPLL---GDDFRFLLASACQQLH 72

  Fly   491 KLYRVNGHIFQAKRFNRRAFCAYCQDRIWGL-----------GRQGFKCIQCKLLVHKKCHKLVQ 544
            :|     .|....|.:.:|...:|...:|.|           .||..:.||.....|.:.|.|..
  Fly    73 EL-----RISFLGREHFQALIMHCFPNLWLLQVDVLPPFFLCPRQRLQLIQIIPKFHPEDHSLAM 132

  Fly   545 KH--CTDQPEPLVKERAEESSDPIPVPLPPLPYEAMSGGAEACETHDHAHIVAPPPPEDPLEPGT 607
            .|  |.            :....||:                  ..||                 
  Fly   133 GHMLCV------------KCQSLIPI------------------NFDH----------------- 150

  Fly   608 QRQYSLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETAS 672
                    |:::|.||:||:.||.:|:.|.|..:||||.:.::.......:..|..|..:. ::.
  Fly   151 --------FQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEVELL-SSL 206

  Fly   673 NHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGII 737
            .|||||.|...||....||.|.:.:.||||.||:|.:....|:.......|:..||.:|....::
  Fly   207 EHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQSVALLVCELGSALEYLQANRVV 271

  Fly   738 YRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEIL-----RGEDYGFSVD 797
            :||:|.||:|||..||..|||:.:... ::......:..||..|:|||:.     ....|.:.||
  Fly   272 HRDIKPDNILLDDAGHAHLTDFNIATR-LQKNALACSMSGTKPYMAPEVFLCALDEVAGYSYPVD 335

  Fly   798 WWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKN 862
            ||:|||:.|||.....||.:       ..||.....:.||...:..||..|.....:|:..|:..
  Fly   336 WWSLGVVAYEMRGNIRPFVV-------HSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTY 393

  Fly   863 PADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLD 906
            |..|:...:|     :...|..:|:|::.:..|::.|.:||..|
  Fly   394 PGARISTRQE-----LHQTPMLRNIDFQRVLEKKIKPIYKPPED 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556 15/64 (23%)
S_TKc 616..884 CDD:214567 85/272 (31%)
STKc_aPKC 620..947 CDD:270740 91/292 (31%)
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 86/298 (29%)
S_TKc 151..405 CDD:214567 84/267 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.