DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and trc

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster


Alignment Length:386 Identity:128/386 - (33%)
Similarity:199/386 - (51%) Gaps:73/386 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 LNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFL 677
            :.|||.::|||||::.:|.:|:.:.|..:|||||::||.:.:.|.:..|:.|:.|...| :|.::
  Fly    90 VEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVEA-DHQWV 153

  Fly   678 VGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLK 742
            |.::..||.|..|:.::||:.|||:|..:.::..|.||..:||.:|.:||::.:|:.|.|:||:|
  Fly   154 VKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIK 218

  Fly   743 LDNVLLDHEGHIKLTDYGMCKEGI---------------RPGDTTSTFC---------------- 776
            .||:|||..||:||:|:|:| .|:               :|.|...| |                
  Fly   219 PDNLLLDARGHLKLSDFGLC-TGLKKSHRTDFYRDLSQAKPSDFIGT-CASLSCSPMDSKRRAES 281

  Fly   777 -------------GTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNT 828
                         |||:|||||:.....||.:.|||:|||::||||.|..||    .|:|| |:|
  Fly   282 WKRNRRALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPF----CSDNP-QDT 341

  Fly   829 EDYLFQVILEKTIRIPRS--LSVRAASVLKGFLNKNPAD-RLGCHRESAFMDIVSHPFFKNMDWE 890
              |...:...:|:..|..  :|..|...:..|..:  || |||..|  ...|:.|.|||:.:|||
  Fly   342 --YRKVMNWRETLIFPPEIPISEEAKETIINFCCE--ADRRLGSQR--GLEDLKSVPFFRGVDWE 400

  Fly   891 LLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQL----TPD-----DDHVIDNIDQSEFE 942
            .:..:....|.:.|  |..|.:|| .||...::::    .|.     .|.|..|.....||
  Fly   401 HIRERPAAIPVEVR--SIDDTSNF-DEFPDVSLEIPSAPIPQGGEIAKDWVFINYTYKRFE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 108/314 (34%)
STKc_aPKC 620..947 CDD:270740 125/379 (33%)
trcNP_001262071.1 OmpH 16..>85 CDD:214922
STKc_NDR_like 91..455 CDD:270750 126/380 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.