DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and gad8

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_588010.1 Gene:gad8 / 2539206 PomBaseID:SPCC24B10.07 Length:569 Species:Schizosaccharomyces pombe


Alignment Length:354 Identity:143/354 - (40%)
Similarity:211/354 - (59%) Gaps:15/354 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 EPGTQRQYSLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVF 668
            :|......:::.|||::|:|:||:.||:.|..|.|.||||:|.:|||.:....::|....|:.|.
pombe   218 KPNQSTPLTIDAFELLKVVGKGSFGKVMQVRKRDTSRIYALKTMKKAHIVSRSEVDHTLAERTVL 282

  Fly   669 ETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHE 733
            ... |:||:|.|...||:|.:|:.|:.||.||:|.:|:||:.......|:||.||:.:||..|||
pombe   283 AQV-NNPFIVPLKFSFQSPGKLYLVLAFVNGGELFHHLQREGCFDTYRAKFYIAELLVALECLHE 346

  Fly   734 KGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDW 798
            ..:||||||.:|:|||:.|||.|.|:|:||..:...|.|:||||||.|:|||:|.|..|...|||
pombe   347 FNVIYRDLKPENILLDYTGHIALCDFGLCKLNMAKTDRTNTFCGTPEYLAPELLLGHGYTKVVDW 411

  Fly   799 WALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNP 863
            |.||||||||:.|..||        .|:|..: :::.||:..:|.|.::..:|..:|.|.|.:.|
pombe   412 WTLGVLLYEMITGLPPF--------YDENINE-MYRKILQDPLRFPDNIDEKAKDLLSGLLTRAP 467

  Fly   864 ADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGE-AVQLTP 927
            ..|||   .....:|.:||||.::||:.|..|::.|||||.::|..|.:||..|||.| .:....
pombe   468 EKRLG---SGGAQEIKNHPFFDDIDWKKLCAKKIQPPFKPSVESAIDTSNFDSEFTSEIPMDSVV 529

  Fly   928 DDDHVIDNIDQSEFEGFEYVNPLLMSLED 956
            .|.|:.:.: |..|..:.|..|..:...|
pombe   530 ADSHLSETV-QQRFANWSYQRPTTIDTSD 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 116/267 (43%)
STKc_aPKC 620..947 CDD:270740 136/327 (42%)
gad8NP_588010.1 YPK1_N_like 66..225 CDD:212165 1/6 (17%)
PTZ00263 214..545 CDD:140289 140/340 (41%)
STKc_YPK1_like 235..547 CDD:270737 136/325 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.