DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and F48G7.9

DIOPT Version :10

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_503271.1 Gene:F48G7.9 / 185997 WormBaseID:WBGene00018620 Length:125 Species:Caenorhabditis elegans


Alignment Length:50 Identity:23/50 - (46%)
Similarity:35/50 - (70%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 KLYRVNGHIFQAKRFNRRAFCAYCQDRIWGLGRQGFKCIQCKLLVHKKCH 540
            |::.|.||.|:|....:...||:|...|:|||:||::|:.|:.:||||||
 Worm    20 KVHEVAGHKFRAAALLQPTCCAFCSKIIYGLGKQGYRCLGCETVVHKKCH 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_aPKC 496..550 CDD:410344 20/44 (45%)
STKc_aPKC 620..947 CDD:270740
F48G7.9NP_503271.1 C1 20..76 CDD:412127 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.