DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and LOC101732362

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:XP_004918050.3 Gene:LOC101732362 / 101732362 -ID:- Length:292 Species:Xenopus tropicalis


Alignment Length:286 Identity:112/286 - (39%)
Similarity:164/286 - (57%) Gaps:18/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 EKHVFE--TASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISL 726
            ||.:.:  |::.|||||.|::.||:.:.||||::::.||||.:.::.|....|..|.||.|.|.|
 Frog    19 EKRILQKVTSAEHPFLVSLYATFQSENHLFFVMKYLPGGDLCHLLEHQGAFEESKAMFYTACIVL 83

  Fly   727 ALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGED 791
            .|..||...|::|||||:|:::|..|::|:.|:|:.|:|.|.||.:.|.|||..|:||||:....
 Frog    84 GLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTRCGTNCYMAPEIIDEMA 148

  Fly   792 YGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLK 856
            |..:||||||||:||.|:..:.|||.....|         ||:.|......:...||..|..::.
 Frog   149 YSRAVDWWALGVVLYVMIMFQFPFDAEDDME---------LFESIRNDKPALTEELSEEAQCLIL 204

  Fly   857 GFLNKNPADRLGCHRESAFMDIVSHPFFKNMDW-ELLERKQVTPPFKPRLDSDRDLANFPPEFTG 920
            ..|.|||..||| ..|:...::.:|.||:::|| |.|||:|: |||||.:..   |.....:...
 Frog   205 RLLEKNPCHRLG-SSEAGAEEVKAHEFFEDIDWEEFLEREQM-PPFKPDVSG---LTESTRQSEC 264

  Fly   921 EAVQLTPDDDHVIDNIDQSEFEGFEY 946
            :|..|.|..: .|....|..||||:|
 Frog   265 QAWGLMPPAE-AISPEAQELFEGFDY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 87/221 (39%)
STKc_aPKC 620..947 CDD:270740 112/286 (39%)
LOC101732362XP_004918050.3 PKc_like 15..292 CDD:419665 112/286 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.