DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aPKC and SGK2

DIOPT Version :9

Sequence 1:NP_001260984.1 Gene:aPKC / 47594 FlyBaseID:FBgn0261854 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_001186193.1 Gene:SGK2 / 10110 HGNCID:13900 Length:367 Species:Homo sapiens


Alignment Length:360 Identity:155/360 - (43%)
Similarity:221/360 - (61%) Gaps:19/360 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 LEPGTQRQYSLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHV 667
            |.|.........||:.::|||:|:|.|||:.:.:.....||:||::|..:...::...:..|:.|
Human    22 LGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSV 86

  Fly   668 FETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLH 732
            ......|||||||...||||.:|:||:::|.||:|.:|:||:||..|..|||||||::.|:.:||
Human    87 LLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLH 151

  Fly   733 EKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVD 797
            ...|||||||.:|:|||.:||:.|||:|:||||:.|.||||||||||.|:|||:||.|.|..:||
Human   152 SLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVD 216

  Fly   798 WWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKN 862
            ||.||.:|||||.|..||.....|:         :::.||.:.::||...:|.|..:|:..|:|:
Human   217 WWCLGAVLYEMLHGLPPFYSQDVSQ---------MYENILHQPLQIPGGRTVAACDLLQSLLHKD 272

  Fly   863 PADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQ--- 924
            ...|||  .::.|::|.:|.||..::|:.|..|::||||.|.:....||.:|.||||.|||.   
Human   273 QRQRLG--SKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSI 335

  Fly   925 -LTPDDDHVIDNID-QSEFEGFEYVNPLLMSLEDC 957
             .|||.  |..:.. .|.|.||.|. |....:.||
Human   336 GCTPDT--VASSSGASSAFLGFSYA-PEDDDILDC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aPKCNP_001260984.1 C1_1 498..550 CDD:278556
S_TKc 616..884 CDD:214567 120/267 (45%)
STKc_aPKC 620..947 CDD:270740 147/331 (44%)
SGK2NP_001186193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 2/3 (67%)
STKc_SGK2 39..359 CDD:270754 148/333 (44%)
Nuclear localization signal. /evidence=ECO:0000250 68..78 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.