DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NELL2 and NimB5

DIOPT Version :9

Sequence 1:XP_016874830.1 Gene:NELL2 / 4753 HGNCID:7751 Length:871 Species:Homo sapiens
Sequence 2:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster


Alignment Length:230 Identity:64/230 - (27%)
Similarity:94/230 - (40%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   424 VESSGCPA-LDCPESHQITLSHSCCKVCKGYD--------FCSERHNCMENSICRNLNDRAVCSC 479
            ||....|: :...::::::|...|   |.||.        .|..:..| :|..|:...:   |.|
  Fly   107 VEKYSYPSVIQTDQANRLSLIEVC---CTGYSASRLMGVTVCRAQCGC-QNGSCKIPGE---CEC 164

Human   480 RDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITN 544
            .|||  :|.||..|  :..|..|   | :|..|. ..||  |.|..|| ::|:........|.:.
  Fly   165 YDGF--VRNDNGDC--VFACPLG---C-QNGQCY-LDGS--CQCDPGY-KLDETRRFCRPICSSG 217

Human   545 -----QHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANVCACPQGFT- 603
                 :|||.|..:         |.|..||......|:..|:..|..||.|...|.|.|..|:. 
  Fly   218 CGSSPRHNCTEPEI---------CGCSKGYQLTDDGCQPVCEPDCGIGGLCKDNNQCDCAPGYNL 273

Human   604 -GPSCETD-IDECSDGFVQCDSRANCINLPGW-YH 635
             ...|:.| ..:|::|.  |.||..|:..||: ||
  Fly   274 RDGVCQADCYQKCNNGV--CVSRNRCLCDPGYTYH 306



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.