DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NELL2 and NimB4

DIOPT Version :9

Sequence 1:XP_016874830.1 Gene:NELL2 / 4753 HGNCID:7751 Length:871 Species:Homo sapiens
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:425 Identity:109/425 - (25%)
Similarity:140/425 - (32%) Gaps:141/425 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   290 HGLVQKIMELQDILAKTSAKLSRAEQRMNRL--DQCYCERTCTMKGTTYREFESWIDGCKNCTCL 352
            |||..::.|.|....|......|||||...|  :....:|..:...||.:.:             
  Fly    23 HGLELQLHEQQLQQQKDEQLRLRAEQRQRELLREHEALQRRLSSSTTTRKPY------------- 74

Human   353 NGTIQCETLICPN----------PD-CPLKSALAY--------------------VDGKCCK--- 383
                     |.||          || |..:....:                    |...|||   
  Fly    75 ---------IIPNGLSLPRRGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWR 130

Human   384 -------ECKSICQFQGRTYFEGER---NTVYSSSGVCVLYECKDQTMKLVES--SGCPALDCPE 436
                   :|...|         |||   |....:.|.||.:  .|..:....:  ..|| |.|| 
  Fly   131 RYEYDWSQCVPDC---------GERCQENGFCVAGGKCVCF--TDFVLNYRNNCVPTCP-LGCP- 182

Human   437 SHQITLSHSCCKVCKGYD------FCSERHN--CMENSICRNLNDRAVCSCRDGF-RALREDNA- 491
             |.....:..|:..|||:      ||..:.|  |..|.:|.   :...|||.:|: |.|||..| 
  Fly   183 -HGRCYLNGTCQCDKGYELDGSRKFCQPQCNATCGHNEVCL---EPGKCSCAEGYTRGLRESAAL 243

Human   492 -------------YCEDIDEC--------------AEGRHY--CRENTMCVNTPGSFMCICKTGY 527
                         :|...:||              .||..|  | ||..|.|   ...|:|:.||
  Fly   244 GCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTC-ENGFCAN---KTTCVCQNGY 304

Human   528 IRIDDYSCTEHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIA 592
             |.|..:.|...:|   ..||| |.:|   :...||.|..||..|...|:|.|..||...|.|||
  Fly   305 -RYDKNTTTCLPDC---GDNCD-NGVC---ISPGNCRCFKGYVRNRERCEAVCVGGCGFYGKCIA 361

Human   593 ANVCACPQGFTGPSCETDIDECSDGFVQCDSRANC 627
            .|||.|.   ..|..|.....|..|......|..|
  Fly   362 PNVCGCA---IVPGPERTYQRCEYGLCNAMGRCRC 393



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.