DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NELL2 and NimB1

DIOPT Version :9

Sequence 1:XP_016874830.1 Gene:NELL2 / 4753 HGNCID:7751 Length:871 Species:Homo sapiens
Sequence 2:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster


Alignment Length:406 Identity:96/406 - (23%)
Similarity:136/406 - (33%) Gaps:127/406 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   381 CCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYE----CKDQTMKLVESSGCPALDCPESHQIT 441
            |.:|..|:       :|:.||::....:|..:.:.    |                 |....:..
  Fly    59 CHREVPSV-------FFQTERDSPVRGNGSTIYFHRIEVC-----------------CAGYRRDP 99

Human   442 LSHSCCKVCKGYDFCSERHNCMENSICRNLNDRAVCSCRDGFRALREDNAYCEDI--DECAEGRH 504
            .::.|...|.    .|...|| .|..||:   ..||.|...|  :|.::..|...  ..|..||.
  Fly   100 YANECVPDCS----ASSPDNC-RNGFCRS---PGVCECFAEF--VRNEHGACIHTCPIACQHGRC 154

Human   505 YCRENTMCVNTPGSFMCICKTGYIRID-----------DYSCTEHDECITNQHNCDENALCFNTV 558
            |....           |:|...:: :|           ..||..|:||                |
  Fly   155 YLNGT-----------CVCHQNFV-LDQETRQFCRPKCSQSCGTHEEC----------------V 191

Human   559 GGHNCVCKPGYTGN-GTTCKAFCKDGCRNGGACIAANVCACPQGF-TGPS---CETDID-ECSDG 617
            ....|.|.|||... ...|:..|...| ..|.|:|.|.|.|..|| ..|:   ||.:.. .|.:|
  Fly   192 APGQCDCSPGYRRTPDLGCQPVCAPDC-GFGKCVAPNQCECFAGFIKRPNWNVCEAECYLNCENG 255

Human   618 FVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESC--EDIDECGTGRHSCANDTI--CFNLD 678
            .  |:||         |.|.||:||.    :..:..||  |..|.||.|...|....:  ||.  
  Fly   256 L--CESR---------YKCHCREGYR----YDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFR-- 303

Human   679 GGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRC---SVCSCQNGFVMCRRMVCDCENPTVD 740
             ||:.   ||..|...|    :.:..|:.     .||   .:|.|..|...||...||    .::
  Fly   304 -GYEV---HGAECRPKC----ESRFCGKY-----GRCVAPEICGCGEGQQHCRNGSCD----DIE 351

Human   741 LFCCPECDPRLSSQCL 756
            ...||..:.....:||
  Fly   352 HCSCPSGETHFIDRCL 367



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.