DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NELL2 and CG32373

DIOPT Version :9

Sequence 1:XP_016874830.1 Gene:NELL2 / 4753 HGNCID:7751 Length:871 Species:Homo sapiens
Sequence 2:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster


Alignment Length:422 Identity:108/422 - (25%)
Similarity:154/422 - (36%) Gaps:102/422 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   414 YECK-DQTMKLVESSGCPALDCPESHQITLSHSCCKVCKG--YDFCSERHNC-MENSICRNLNDR 474
            |.|: :..:|..:.:   ||.|.....:.|..:|.|:.||  :....::..| ::|..|.::.:|
  Fly    76 YSCRVNYKLKRAKDN---ALYCSNGIWLGLKPNCIKIGKGNTHSMKQKKMRCRIDNGGCAHICNR 137

Human   475 AV--CSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGY--IRIDDYSC 535
            :.  |.|.:|:.....|...|.|||||.|....|.:  :|.|.||.|:|.|.:|:  ...|:.:|
  Fly   138 STHKCECYEGYTLNSTDLRSCNDIDECKESNGGCSQ--VCNNLPGEFICTCNSGFEIDESDEKTC 200

Human   536 TEHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANVCACPQ 600
            .:.|||...:.:.|..|.|.|..|.:.|:  |...|.......   ||...|       ...|..
  Fly   201 LDIDECADPELSWDCTAGCKNLNGTYKCL--PSLVGRVEPTDG---DGFSPG-------EIVCKS 253

Human   601 GF----TGPSCETDIDECSDGFVQCDS--------RANCINLPGWYHCECRDGYH---------- 643
            ||    .|..|: ||:||....:..||        ...|.|..|.|.|.|..|||          
  Fly   254 GFKLSDDGSECQ-DINECDLADIDSDSWRMTYRYCEHKCENTVGSYICHCPQGYHLLDDQNSCIL 317

Human   644 DNGMFSPSGES-----------CEDIDECGTGRHSCANDTICFNLDGGYD-CRCPHGKNCTGDCI 696
            |.....||.::           |........|:.||..     .|..|:: .||  ...|....|
  Fly   318 DGSKLPPSKDAPVSQEAPRKDICPLFKGPANGKASCDK-----YLQNGFNYTRC--NITCNAGYI 375

Human   697 HDGK----VKHNGQIWVLENDRC---SVCSC------QNGFVMCRRMVCDCEN-PTVDLFCCP-E 746
            ..|.    ..|.| :|.....:|   ...||      :||    |.....|.| |:..|..|. .
  Fly   376 MQGSQFAVCGHTG-LWSSPEAKCVESLALSCPVLTPPRNG----RFYPASCNNEPSKSLAICELL 435

Human   747 CD----PRLSSQ--CLHQNGETLYNSGDTWVQ 772
            ||    ||:.:|  |....|         |:|
  Fly   436 CDRGYLPRMDTQLICAAPWG---------WIQ 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NELL2XP_016874830.1 None
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 8/33 (24%)
vWFA <158..199 CDD:294047 17/42 (40%)
FXa_inhibition 287..315 CDD:291342 9/27 (33%)
CCP 340..398 CDD:153056 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.