DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NELL2 and shf

DIOPT Version :9

Sequence 1:XP_016874830.1 Gene:NELL2 / 4753 HGNCID:7751 Length:871 Species:Homo sapiens
Sequence 2:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster


Alignment Length:394 Identity:97/394 - (24%)
Similarity:135/394 - (34%) Gaps:132/394 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   395 TYFEGERNTVYSSSGVCVLYE--CKDQTMKLVESSGCPA--------LDCPESHQITLSHSC-CK 448
            |:..|.|...|....:..:.|  .|..|:.:.:|...|.        |.|..:...|.|.:. .|
  Fly   175 TWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLK 239

Human   449 VCKGYDFCSERHNCMENSICRNLNDRAVCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCV 513
            :       ..|||...:.....||.:..|:.|..:           |||         ..|...:
  Fly   240 I-------QTRHNKPLSGTPIRLNFKKECAHRGVY-----------DID---------ASNPTSL 277

Human   514 NT-----PGSFMCICKTGYIRIDDYSCTEHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNG 573
            .|     |...:...|.||       |.||                      |.|.|..||||. 
  Fly   278 TTLQAPDPECSLKCGKNGY-------CNEH----------------------HICKCNVGYTGQ- 312

Human   574 TTCK-AFCKDGCRNGGACIAANVCACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCE 637
             .|: |||...|.|||.|.|.:||.||:|:.|..||..|  |.|   :|.:...||...   .|:
  Fly   313 -YCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGI--CKD---KCLNGGKCIQKD---KCQ 368

Human   638 CRDGYHDNGMFSPSGESCEDIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVK 702
            |..||:        |..|| ..:|..   .|.|:..|.   |...||||:|              
  Fly   369 CSKGYY--------GLRCE-YSKCVI---PCKNEGRCI---GNNLCRCPNG-------------- 404

Human   703 HNGQIWVLENDRC-------SVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNG 760
                   |..|.|       |:|.|:||..:..:. |.| :|.   |....|:.| ..:.:|:|.
  Fly   405 -------LRGDHCEIGRKQRSICKCRNGTCVSHKH-CKC-HPG---FYGRHCNGR-KRRHVHRND 456

Human   761 ETLY 764
            ::.:
  Fly   457 DSKF 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NELL2XP_016874830.1 None
shfNP_001284963.1 WIF 137..258 CDD:280237 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.