DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEK3 and niki

DIOPT Version :9

Sequence 1:NP_002489.1 Gene:NEK3 / 4752 HGNCID:7746 Length:506 Species:Homo sapiens
Sequence 2:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster


Alignment Length:252 Identity:102/252 - (40%)
Similarity:157/252 - (62%) Gaps:3/252 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     3 DYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPK-SFSNTQNSRKEAVLLAKMKHPNIVAFK 66
            :|..:|::|:||||.|:|.:.:|.......|:|.|.: |......:..|..:.:|:.|||||::.
  Fly   104 NYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYL 168

Human    67 ESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKL-FPEDMILNWFTQMCLGVNHIHKKRVLHRDIKS 130
            .||..:..|.|.|||.|||.|.|.|.:::||| |||..|:..|.|:...:|::|.:.:||||:|:
  Fly   169 GSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKT 233

Human   131 KNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYEL 195
            .|:||.:.|.||:||||.:::: |....|.|.:|||||..||:.|...|:||||||:|||||.|:
  Fly   234 ANVFLNRRGIVKIGDFGISKIM-NTKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEM 297

Human   196 CTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLL 252
            |.||..|.|::...|:.|:..|..:|:||.|:..|:.|:..:.:.....||:|:.:|
  Fly   298 CCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEK3NP_002489.1 Interaction with VAV2. /evidence=ECO:0000269|PubMed:15618286 1..285 102/252 (40%)
STKc_Nek3 3..257 CDD:173759 102/252 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..325
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..490
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 102/252 (40%)
S_TKc 105..354 CDD:214567 101/249 (41%)
ATS1 445..747 CDD:227511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.