DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEK1 and niki

DIOPT Version :9

Sequence 1:NP_001186326.1 Gene:NEK1 / 4750 HGNCID:7744 Length:1286 Species:Homo sapiens
Sequence 2:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster


Alignment Length:328 Identity:127/328 - (38%)
Similarity:193/328 - (58%) Gaps:36/328 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQ 65
            :..|.:::.:|:||||.|||.:...||.|.|.|:||:|.:|...|:.:..||.|.:.:.|||||.
  Fly   102 LANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVS 166

Human    66 YRESFEENGSLYIVMDYCEGGDLFKRINAQKGVL-FQEDQILDWFVQICLALKHVHDRKILHRDI 129
            |..||.::.:|.|.|:|.:||.|.:.|..::|.| |.|..|:..|.||..|:.::|...|||||:
  Fly   167 YLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDL 231

Human   130 KSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLY 194
            |:.|:||.:.|.|::|||||::::|:.:. |:|.:|||||.|||:||.|.|:||||||||||:|.
  Fly   232 KTANVFLNRRGIVKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILG 295

Human   195 ELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSIL------ 253
            |:|.||..|.|.::..||.||::|::.||...|:..||||:|.|.:.....||:.:.:|      
  Fly   296 EMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPL 360

Human   254 -------EKGFIAKRIEKFLSPQLIAEEFCLKTFSKFGSQPIPAKRPASGQNSISV---MP-AQK 307
                   .||:..:  :....|               ||..:.|..||:..:::|:   :| ||.
  Fly   361 IFRSLGKNKGYSYE--DDVGGP---------------GSDQLTAPVPAAAYSNVSMELELPTAQT 408

Human   308 ITK 310
            .||
  Fly   409 ETK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEK1NP_001186326.1 STKc_Nek1 3..258 CDD:270858 115/268 (43%)
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 113/255 (44%)
S_TKc 105..354 CDD:214567 112/249 (45%)
ATS1 445..747 CDD:227511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.