DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ytr and Snrnp27

DIOPT Version :9

Sequence 1:NP_001286785.1 Gene:ytr / 47457 FlyBaseID:FBgn0021895 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_079941.1 Gene:Snrnp27 / 66618 MGIID:1913868 Length:155 Species:Mus musculus


Alignment Length:203 Identity:88/203 - (43%)
Similarity:107/203 - (52%) Gaps:57/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRSRSPASPAHRRREKERSERKKRRERRSREREAIGVAPAGGSGSGGAGRRDRERDRDRSRSRD 65
            ||||||            ||.|::||..||..                   ||||| |.|.|||.
Mouse     1 MGRSRS------------RSPRRERRRSRSTS-------------------RDRER-RRRERSRS 33

  Fly    66 RERERERDRARS---RRSRSRSRVAGGGGGGGGGGSSGGNSSSGPSTSRRTTRNNAAATAADRPK 127
            |||:|.|.|:||   |||||..|                :.|:.||.||...|.:.........|
Mouse    34 RERDRRRSRSRSPHRRRSRSPRR----------------HRSTSPSPSRLKERRDEEKKETKEIK 82

  Fly   128 -----INEADLEGKSPEEVEMLKTMGFCTFDTTKNRKVEGN-DVGEVHVILKRKYRQYMNRKGGF 186
                 |.|.|||||:.||:||:|.|||.:||:||.:||:|: :...::|..||||||||||||||
Mouse    83 NKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGF 147

  Fly   187 NRPLDFVA 194
            ||||||:|
Mouse   148 NRPLDFIA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ytrNP_001286785.1 DUF1777 <124..190 CDD:285811 40/71 (56%)
Snrnp27NP_079941.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 49/142 (35%)
DUF1777 98..154 CDD:400810 35/55 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8767
eggNOG 1 0.900 - - E1_KOG3263
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4693
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006213
OrthoInspector 1 1.000 - - oto94029
orthoMCL 1 0.900 - - OOG6_103584
Panther 1 1.100 - - LDO PTHR31077
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1369
SonicParanoid 1 1.000 - - X4489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.