DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ytr and snrnp27

DIOPT Version :9

Sequence 1:NP_001286785.1 Gene:ytr / 47457 FlyBaseID:FBgn0021895 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001005142.1 Gene:snrnp27 / 448731 XenbaseID:XB-GENE-1002864 Length:156 Species:Xenopus tropicalis


Alignment Length:198 Identity:88/198 - (44%)
Similarity:106/198 - (53%) Gaps:46/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRSRSPASPAHRRREKERSERKKRRERRSREREAIGVAPAGGSGSGGAGRRDRERDRDRSRSRD 65
            |||||| .|| .||||:.||      ...|||||                ||.|||.|.|.|.|.
 Frog     1 MGRSRS-RSP-ERRRERRRS------RSASRERE----------------RRRRERSRSRERRRS 41

  Fly    66 RERERERDRARS-RRSRSRSRVAGGGGGGGGGGSSGGNSSSGPSTSRR--TTRNNAAATAADRPK 127
            |.|...|.|:|| ||.||.|                  .|.|....||  ..:::..:..|...:
 Frog    42 RSRSPHRRRSRSPRRHRSSS------------------ISPGRLKDRRDDDKKDSKESKGAKERQ 88

  Fly   128 INEADLEGKSPEEVEMLKTMGFCTFDTTKNRKVEGN-DVGEVHVILKRKYRQYMNRKGGFNRPLD 191
            |...|||||:.||:||:|.|||.||||:|.:||:|: :...::|..|||||||||||||||||||
 Frog    89 IAAEDLEGKTEEEIEMMKMMGFATFDTSKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLD 153

  Fly   192 FVA 194
            |:|
 Frog   154 FIA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ytrNP_001286785.1 DUF1777 <124..190 CDD:285811 39/66 (59%)
snrnp27NP_001005142.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 49/138 (36%)
DUF1777 109..155 CDD:370033 30/45 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8514
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4615
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627375at2759
OrthoFinder 1 1.000 - - FOG0006213
OrthoInspector 1 1.000 - - oto104250
Panther 1 1.100 - - LDO PTHR31077
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1369
SonicParanoid 1 1.000 - - X4489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.