DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ytr and snrnp27

DIOPT Version :9

Sequence 1:NP_001286785.1 Gene:ytr / 47457 FlyBaseID:FBgn0021895 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001002703.1 Gene:snrnp27 / 436976 ZFINID:ZDB-GENE-040718-457 Length:158 Species:Danio rerio


Alignment Length:200 Identity:84/200 - (42%)
Similarity:107/200 - (53%) Gaps:48/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRSRSPASPAHRRREKERSERKKR-RERRSREREAIGVAPAGGSGSGGAGRRDRERDRDRSRSR 64
            ||||||...|   |||:.||....| ||||.||||                 |.|.|||||.|||
Zfish     1 MGRSRSRTPP---RRERRRSRSSSRDRERRRRERE-----------------RSRSRDRDRRRSR 45

  Fly    65 DRERERERDRARSRRSRSRSRVAGGGGGGGGGGSSGGNSSSGPSTSRRTTRNNAAATAADRP--- 126
            .|...|.|.|: .||.||                    ||..| ..::..|::......::|   
Zfish    46 SRSPHRRRSRS-PRRHRS--------------------SSLSP-LRQKDRRDDDRKDVKEKPAKV 88

  Fly   127 -KINEADLEGKSPEEVEMLKTMGFCTFDTTKNRKVEGN-DVGEVHVILKRKYRQYMNRKGGFNRP 189
             :|:..|::||:.||:||:|.|||.:|:|:|.:|.:|: ....|:|..|||||||||||||||||
Zfish    89 HQISAEDMQGKTEEEIEMMKLMGFGSFETSKGKKKDGSIKAFAVNVSQKRKYRQYMNRKGGFNRP 153

  Fly   190 LDFVA 194
            |||:|
Zfish   154 LDFIA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ytrNP_001286785.1 DUF1777 <124..190 CDD:285811 36/70 (51%)
snrnp27NP_001002703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..100 47/140 (34%)
DUF1777 <43..154 CDD:285811 51/132 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9217
eggNOG 1 0.900 - - E1_KOG3263
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4736
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627375at2759
OrthoFinder 1 1.000 - - FOG0006213
OrthoInspector 1 1.000 - - oto40005
orthoMCL 1 0.900 - - OOG6_103584
Panther 1 1.100 - - LDO PTHR31077
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1369
SonicParanoid 1 1.000 - - X4489
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.