DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ytr and Snrnp27

DIOPT Version :9

Sequence 1:NP_001286785.1 Gene:ytr / 47457 FlyBaseID:FBgn0021895 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001102106.1 Gene:Snrnp27 / 362392 RGDID:1310925 Length:155 Species:Rattus norvegicus


Alignment Length:203 Identity:88/203 - (43%)
Similarity:107/203 - (52%) Gaps:57/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRSRSPASPAHRRREKERSERKKRRERRSREREAIGVAPAGGSGSGGAGRRDRERDRDRSRSRD 65
            ||||||            ||.|::||..||..                   ||||| |.|.|||.
  Rat     1 MGRSRS------------RSPRRERRRSRSTS-------------------RDRER-RRRERSRS 33

  Fly    66 RERERERDRARS---RRSRSRSRVAGGGGGGGGGGSSGGNSSSGPSTSRRTTRNNAAATAADRPK 127
            |||:|.|.|:||   |||||..|                :.|:.||.||...|.:.........|
  Rat    34 RERDRRRSRSRSPHRRRSRSPRR----------------HRSTSPSPSRLKERRDEEKKETKEVK 82

  Fly   128 -----INEADLEGKSPEEVEMLKTMGFCTFDTTKNRKVEGN-DVGEVHVILKRKYRQYMNRKGGF 186
                 |.|.|||||:.||:||:|.|||.:||:||.:||:|: :...::|..||||||||||||||
  Rat    83 NKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGF 147

  Fly   187 NRPLDFVA 194
            ||||||:|
  Rat   148 NRPLDFIA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ytrNP_001286785.1 DUF1777 <124..190 CDD:285811 40/71 (56%)
Snrnp27NP_001102106.1 DUF1777 98..154 CDD:400810 35/55 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3263
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627375at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.