DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ytr and snrp-27

DIOPT Version :9

Sequence 1:NP_001286785.1 Gene:ytr / 47457 FlyBaseID:FBgn0021895 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001369953.1 Gene:snrp-27 / 172652 WormBaseID:WBGene00011035 Length:155 Species:Caenorhabditis elegans


Alignment Length:196 Identity:71/196 - (36%)
Similarity:92/196 - (46%) Gaps:45/196 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRSRSPASPAHRRREKERSERKKRRERRSREREAIGVAPAGGSGSGGAGRRDRERDRDRSRS-R 64
            |||.|| .|...:||.:.||..::|...|||||.           .....|.::|:...|||| |
 Worm     1 MGRDRS-RSRDRKRRSRSRSVERRRERSRSRERR-----------DARKNRDEKEKRSSRSRSPR 53

  Fly    65 DRERERERDRARSRRSRSRSRVAGGGGGGGGGGSSGGNSSSGPSTSRRTTRNNAAATAADRPKIN 129
            |:...|||.|:|.|:.|.|.|                         ::..|.     ...|.|..
 Worm    54 DKRDRRERSRSRDRKERDRER-------------------------QKKDRE-----PKKREKQE 88

  Fly   130 EADLEG--KSPEEVEMLKTMGFCTFDTTKNRKVEGNDVGEVHVILKRKYRQYMNRKGGFNRPLDF 192
            |..||.  ...::..|:..|||..||||||::|..|..|.|::...|:|||||||||||||||||
 Worm    89 EISLESLQSGADDEAMMAAMGFGGFDTTKNKQVNDNVDGCVNIKKPRRYRQYMNRKGGFNRPLDF 153

  Fly   193 V 193
            :
 Worm   154 M 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ytrNP_001286785.1 DUF1777 <124..190 CDD:285811 33/67 (49%)
snrp-27NP_001369953.1 DUF1777 100..154 CDD:400810 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I6326
eggNOG 1 0.900 - - E1_KOG3263
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I3611
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627375at2759
OrthoFinder 1 1.000 - - FOG0006213
OrthoInspector 1 1.000 - - oto17999
orthoMCL 1 0.900 - - OOG6_103584
Panther 1 1.100 - - LDO PTHR31077
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1369
SonicParanoid 1 1.000 - - X4489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.