DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ytr and SNRNP27

DIOPT Version :9

Sequence 1:NP_001286785.1 Gene:ytr / 47457 FlyBaseID:FBgn0021895 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_006848.1 Gene:SNRNP27 / 11017 HGNCID:30240 Length:155 Species:Homo sapiens


Alignment Length:203 Identity:88/203 - (43%)
Similarity:109/203 - (53%) Gaps:57/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRSRSPASPAHRRREKERSERKKRRERRSREREAIGVAPAGGSGSGGAGRRDRERDRDRSRSRD 65
            ||||||            ||.|::||..||..||                   ||| |.|.|||.
Human     1 MGRSRS------------RSPRRERRRSRSTSRE-------------------RER-RRRERSRS 33

  Fly    66 RERERERDRARS---RRSRSRSRVAGGGGGGGGGGSSGGNSSSGPSTSRRTTRNN-----AAATA 122
            |||:|.|.|:||   |||||..|                :.|:.||.||...|.:     ...|.
Human    34 RERDRRRSRSRSPHRRRSRSPRR----------------HRSTSPSPSRLKERRDEEKKETKETK 82

  Fly   123 ADRPKINEADLEGKSPEEVEMLKTMGFCTFDTTKNRKVEGN-DVGEVHVILKRKYRQYMNRKGGF 186
            :...:|.|.|||||:.||:||:|.|||.:||:||.:||:|: :...::|..||||||||||||||
Human    83 SKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGF 147

  Fly   187 NRPLDFVA 194
            ||||||:|
Human   148 NRPLDFIA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ytrNP_001286785.1 DUF1777 <124..190 CDD:285811 39/66 (59%)
SNRNP27NP_006848.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97 50/143 (35%)
DUF1777 98..154 CDD:400810 35/55 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8838
eggNOG 1 0.900 - - E1_KOG3263
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627375at2759
OrthoFinder 1 1.000 - - FOG0006213
OrthoInspector 1 1.000 - - oto90444
orthoMCL 1 0.900 - - OOG6_103584
Panther 1 1.100 - - LDO PTHR31077
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1369
SonicParanoid 1 1.000 - - X4489
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.