DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NELL1 and shf

DIOPT Version :9

Sequence 1:NP_001275642.1 Gene:NELL1 / 4745 HGNCID:7750 Length:838 Species:Homo sapiens
Sequence 2:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster


Alignment Length:241 Identity:65/241 - (26%)
Similarity:92/241 - (38%) Gaps:79/241 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   507 ECGSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICR-AFCEEGCRYGGTCVAPNKCVCPSGFT 570
            ||..   .|.:|..|.   :.|.|.|..||.|.  .|. |||...|..||.|.||:.|.||.|:.
  Fly   286 ECSL---KCGKNGYCN---EHHICKCNVGYTGQ--YCETAFCFPQCLNGGNCTAPSVCTCPEGYQ 342

Human   571 GSHCEKDIDECSEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDECALRTHTC 635
            |:.||..|  |.:   :|.|..:|:...   .|:|..|::        |..| :..:|.:   .|
  Fly   343 GTQCEGGI--CKD---KCLNGGKCIQKD---KCQCSKGYY--------GLRC-EYSKCVI---PC 387

Human   636 WNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRC-------SVCSCKDGKIF 693
            .|:..||   |...|.||:|                     |:.|.|       |:|.|::|...
  Fly   388 KNEGRCI---GNNLCRCPNG---------------------LRGDHCEIGRKQRSICKCRNGTCV 428

Human   694 CRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHK---LYRSGDN 736
            ..: .|.| :|.   |....|           ||.|   ::|:.|:
  Fly   429 SHK-HCKC-HPG---FYGRHC-----------NGRKRRHVHRNDDS 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NELL1NP_001275642.1 TSPN 57..241 CDD:214560
VWC 301..359 CDD:278520
EGF_CA 462..>494 CDD:214542
EGF_3 508..543 CDD:289699 10/34 (29%)
EGF_CA 577..614 CDD:214542 8/36 (22%)
EGF_CA 624..>655 CDD:284955 9/30 (30%)
VWC 662..714 CDD:302663 11/58 (19%)
VWC 729..777 CDD:302663 3/11 (27%)
shfNP_001284963.1 WIF 137..258 CDD:280237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.